Stem Cell Growth Factor Beta (SCGF) is a secreted sulfated glycoprotein that belongs to the C-type lectin superfamily and is expressed primarily in hematopoietic tissues. It functions as a growth factor for primitive hematopoietic progenitor cells. SCGF-beta is a truncated variant of SCGF that has a 78 amino acid residue deletion and lacks a functional calcium-dependent carbohydrate-recognition domain. The amino acid sequence of human SCGF is 85% identical to mouse and rat SCGF.
SCGF/CLEC11a Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-88076
![SCGF/CLEC11a Antibody - BSA Free Immunocytochemistry/ Immunofluorescence: SCGF/CLEC11a Antibody - BSA Free [NBP1-88076]](https://resources.rndsystems.com/images/products/nbp1-88076_rabbit-polyclonal-scgf-clec11a-antibody-6520251621541.jpg "Immunocytochemistry/ Immunofluorescence: SCGF/CLEC11a Antibody - BSA Free [NBP1-88076]")
Loading...
Key Product Details
Species Reactivity
Human
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LYLFENGQRVSFFAWHRSPRPELGAQPSASPHPLSPDQPNGGTLENCVAQASDDGSWWDHDCQRRLYYVCEFPF
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (88%)
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for SCGF/CLEC11a Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence: SCGF/CLEC11a Antibody - BSA Free [NBP1-88076]
Staining of human cell line A-431 shows localization to centrosome.![SCGF/CLEC11a Antibody - BSA Free Immunohistochemistry-Paraffin: SCGF/CLEC11a Antibody - BSA Free [NBP1-88076]](https://resources.rndsystems.com/images/products/nbp1-88076_rabbit-polyclonal-scgf-clec11a-antibody-6520251617113.jpg "Immunohistochemistry-Paraffin: SCGF/CLEC11a Antibody - BSA Free [NBP1-88076]")
Immunohistochemistry-Paraffin: SCGF/CLEC11a Antibody - BSA Free [NBP1-88076]
Staining of human placenta shows moderate cytoplasmic/membranous positivity in trophoblastic cells.![SCGF/CLEC11a Antibody - BSA Free Immunohistochemistry-Paraffin: SCGF/CLEC11a Antibody - BSA Free [NBP1-88076]](https://resources.rndsystems.com/images/products/nbp1-88076_rabbit-polyclonal-scgf-clec11a-antibody-65202516291310.jpg "Immunohistochemistry-Paraffin: SCGF/CLEC11a Antibody - BSA Free [NBP1-88076]")
Immunohistochemistry-Paraffin: SCGF/CLEC11a Antibody - BSA Free [NBP1-88076]
Staining of human liver shows strong cytoplasmic-membranous positivity in hepatocytes.![SCGF/CLEC11a Antibody - BSA Free Immunohistochemistry-Paraffin: SCGF/CLEC11a Antibody - BSA Free [NBP1-88076]](https://resources.rndsystems.com/images/products/nbp1-88076_rabbit-polyclonal-scgf-clec11a-antibody-65202516254514.jpg "Immunohistochemistry-Paraffin: SCGF/CLEC11a Antibody - BSA Free [NBP1-88076]")
Immunohistochemistry-Paraffin: SCGF/CLEC11a Antibody - BSA Free [NBP1-88076]
Staining of human cerebral cortex shows strong cytoplasmic positivity in endothelial cells.![SCGF/CLEC11a Antibody - BSA Free Immunohistochemistry-Paraffin: SCGF/CLEC11a Antibody - BSA Free [NBP1-88076]](https://resources.rndsystems.com/images/products/nbp1-88076_rabbit-polyclonal-scgf-clec11a-antibody-6520251627250.jpg "Immunohistochemistry-Paraffin: SCGF/CLEC11a Antibody - BSA Free [NBP1-88076]")
Immunohistochemistry-Paraffin: SCGF/CLEC11a Antibody - BSA Free [NBP1-88076]
Staining of human endometrium shows strong cytoplasmic positivity in stromal cells.Applications for SCGF/CLEC11a Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:50 - 1:200
Immunohistochemistry-Paraffin
1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: SCGF/CLEC11a
Long Name
Stem Cell Growth Factor/C-type Lectin Domain Family 11, Member A
Alternate Names
CLEC11a, CLECSF3, LSLCL
Gene Symbol
CLEC11A
Additional SCGF/CLEC11a Products
Product Documents for SCGF/CLEC11a Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for SCGF/CLEC11a Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for SCGF/CLEC11a Antibody - BSA Free
There are currently no reviews for this product. Be the first to review SCGF/CLEC11a Antibody - BSA Free and earn rewards!
Have you used SCGF/CLEC11a Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...