SCN11A Antibody (2B10) - Azide and BSA Free

Novus Biologicals | Catalog # H00011280-M02

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 2B10

Format

Azide and BSA Free
View all SCN11A Primary Antibodies »

Product Specifications

Immunogen

SCN11A (NP_054858, 1726 a.a. ~ 1791 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TTTKRKEEERGAAIIQKAFRKYMMKVTKGDQGDQNDLENGPHSPLQTLCNGDLSSFGVAKGKVHCD

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Scientific Data Images for SCN11A Antibody (2B10) - Azide and BSA Free

Western Blot: SCN11A Antibody (2B10) [H00011280-M02]

Western Blot: SCN11A Antibody (2B10) [H00011280-M02]

Western Blot: SCN11A Antibody (2B10) [H00011280-M02] - Detection against Immunogen (33 KDa).

Applications for SCN11A Antibody (2B10) - Azide and BSA Free

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
This antibody is useful for ELISA, Western Blot

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: SCN11A

Voltage-gated sodium channels are membrane protein complexes that play a fundamental role in generating and transmitting action potentials in neuronal cells. SCN11A (Sodium channel, voltage-gated, type XI, alpha subunit) mediates the voltage-dependent sodium ion permeability and conductance. It forms the pore of the sodium-selective channel through which sodium ions may pass in accordance with their electrochemical gradient. It is a tetrodotoxin-resistant sodium channel isoform.

Long Name

Sodium channel protein type 11 subunit alpha

Alternate Names

hNaN, PN5, SCN12A, SNS2

Gene Symbol

SCN11A

UniProt

NP_054858 (Human)

Additional SCN11A Products

Product Documents for SCN11A Antibody (2B10) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SCN11A Antibody (2B10) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SCN11A Antibody (2B10) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review SCN11A Antibody (2B10) - Azide and BSA Free and earn rewards!

Have you used SCN11A Antibody (2B10) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies