SCYL1BP1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35737

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SCYL1BP1 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SCYL1BP1 (NP_001139511.1).

Sequence:
MSWAAVLAVAAARFGHFWGCRWPGPMAQGWAGFSEEELRRLKQTKDPFEPQRRLPAKKSRQQLQREKALVEQSQKLGLQDGSTSLLPEQLLSAPKQRVNV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

42 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for SCYL1BP1 Antibody - BSA Free

SCYL1BP1 Antibody

Western Blot: SCYL1BP1 Antibody [NBP3-35737] -

Western Blot: SCYL1BP1 Antibody [NBP3-35737] - Western blot analysis of various lysates using SCYL1BP1 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 1s.

Applications for SCYL1BP1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: SCYL1BP1

NTKL-binding protein 1 (GORAB) belongs to the golgin family of coiled-coil proteins located in the golgi apparatus. GORAB interacts with SCYL1, RCHY1 and RAB6A/RAB6. At least 4 isoforms are produced by alternative splicing.

Alternate Names

FLJ11752, golgin, RAB6-interacting, GONTKL-binding protein 1, hNTKL-BP1, MGC51263, MGC70512, N-terminal kinase-like-binding protein 1, NTKL-BP1, NTKLBP1SCY1-like 1-binding protein 1, RAB6-interacting golgin, SCY1-like 1 binding protein 1, SCYL1-BP1, SCYL1BP1SCYL1-binding protein 1

Gene Symbol

GORAB

Additional SCYL1BP1 Products

Product Documents for SCYL1BP1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SCYL1BP1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SCYL1BP1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SCYL1BP1 Antibody - BSA Free and earn rewards!

Have you used SCYL1BP1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies