SDCCAG8 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-55249

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LIQCDQLRKELERQAERLEKELASQQEKRAIEKDMMKKEITKEREYMGSKMLILSQNIAQLEAQVEKVTKEKISAINQLEEIQSQLASREMDVTKV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SDCCAG8 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: SDCCAG8 Antibody [NBP2-55249]

Immunocytochemistry/ Immunofluorescence: SDCCAG8 Antibody [NBP2-55249]

Immunocytochemistry/Immunofluorescence: SDCCAG8 Antibody [NBP2-55249] - Staining of human cell line A-431 shows localization to centrosome.

Applications for SDCCAG8 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SDCCAG8

SDCCAG8 is a gene that codes for a protein with four isoforms, with weights of 713, 360, 634, and 669 amino acids and weights of approximately 83, 41, 73, and 78 kDa respectively. The protein coded by SDCCAG8 helps in the formation of epithelial lumen as well as the establishment of cell polarity and is expressed in the thymus, prostate, testis, ovary, small intestine and mucosa as well as in colon and renal cancer tumors. Current studies are being done on several diseases and disorders linked to this gene including colon cancer, Senior-Loken syndrome, Bardet-Biegl syndrome, retinitis, nystagmus, eye disease, polydactyly, multiple sclerosis, and prostatitis. SDCCAG8 has also been shown to have interactions with TSC1, TRAF6, ALMS1, CEP152, and CEP164 in pathways such as the centrosome maturation, cell cycle, and G2/M transition pathways.

Alternate Names

CCCAPAntigen NY-CO-8, Centrosomal colon cancer autoantigen protein, hCCCAP, NPHP10, NY-CO-8, serologically defined colon cancer antigen 8, SLSN7

Gene Symbol

SDCCAG8

Additional SDCCAG8 Products

Product Documents for SDCCAG8 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SDCCAG8 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SDCCAG8 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SDCCAG8 Antibody - BSA Free and earn rewards!

Have you used SDCCAG8 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...