SEC23IP Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-58361

Novus Biologicals
Loading...

Key Product Details

Validated by

Knockout/Knockdown, Independent Antibodies

Species Reactivity

Human

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence, Knockdown Validated

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: CPGPLAVANGVVKQLHFQEKQMPEEPKLTLDESYDLVVENEEVLTLQETLEALSLSEYFSTFEKEKIDMESLLMCTVDDLKEM

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SEC23IP Antibody - BSA Free

Western Blot: SEC23IP Antibody [NBP2-58361]

Western Blot: SEC23IP Antibody [NBP2-58361]

Western Blot: SEC23IP Antibody [NBP2-58361] - Analysis using Anti-SEC23IP antibody NBP2-58361 (A) shows similar pattern to independent antibody NBP1-82456 (B).
Immunocytochemistry/ Immunofluorescence: SEC23IP Antibody [NBP2-58361]

Immunocytochemistry/ Immunofluorescence: SEC23IP Antibody [NBP2-58361]

Immunocytochemistry/Immunofluorescence: SEC23IP Antibody [NBP2-58361] - Staining of human cell line U-2 OS shows localization to vesicles.
Western Blot: SEC23IP Antibody [NBP2-58361]

Western Blot: SEC23IP Antibody [NBP2-58361]

Western Blot: SEC23IP Antibody [NBP2-58361] - Analysis in A-549 cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented. Loading control: Anti-GAPDH.

Applications for SEC23IP Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SEC23IP

COPII-coated vesicles are involved in protein transport from the endoplasmic reticulum to the Golgi apparatus. The protein encoded by this gene was identified by its interaction with a mouse protein similar to yeast Sec23p, an essential component of the COPII. This protein shares significant similarity with phospholipid-modifying proteins, especially phosphatidic acid preferring-phospholipase A1. Overexpression of this protein has been shown to cause disorganization of the endoplasmic reticulum-Golgi intermediate compartment and Golgi apparatus, which suggests its role in the early secretory pathway.

Alternate Names

p125, P125A, SEC23 interacting protein, SEC23-interacting protein

Gene Symbol

SEC23IP

Additional SEC23IP Products

Product Documents for SEC23IP Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SEC23IP Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SEC23IP Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SEC23IP Antibody - BSA Free and earn rewards!

Have you used SEC23IP Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...