SEC61B Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-13290

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: AAGSTVRQRKNASCGTRSAGRTTSAGTGGMWRFYTEDSPGLK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SEC61B Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: SEC61B Antibody [NBP2-13290]

Immunocytochemistry/ Immunofluorescence: SEC61B Antibody [NBP2-13290]

Immunocytochemistry/Immunofluorescence: SEC61B Antibody [NBP2-13290] - Staining of human cell line PC-3 shows localization to endoplasmic reticulum. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: SEC61B Antibody [NBP2-13290]

Immunohistochemistry-Paraffin: SEC61B Antibody [NBP2-13290]

Immunohistochemistry-Paraffin: SEC61B Antibody [NBP2-13290] - Staining of human cerebellum shows moderate to strong positivity in endoplasmic reticulum in Purkinje cells.
Immunohistochemistry-Paraffin: SEC61B Antibody [NBP2-13290]

Immunohistochemistry-Paraffin: SEC61B Antibody [NBP2-13290]

Immunohistochemistry-Paraffin: SEC61B Antibody [NBP2-13290] - Staining of human pancreas shows moderate to strong positivity in endoplasmic reticulum in exocrine glandular cells.
Immunohistochemistry-Paraffin: SEC61B Antibody [NBP2-13290]

Immunohistochemistry-Paraffin: SEC61B Antibody [NBP2-13290]

Immunohistochemistry-Paraffin: SEC61B Antibody [NBP2-13290] - Staining of human liver shows moderate positivity in endoplasmic reticulum in hepatocytes.
Immunohistochemistry-Paraffin: SEC61B Antibody [NBP2-13290]

Immunohistochemistry-Paraffin: SEC61B Antibody [NBP2-13290]

Immunohistochemistry-Paraffin: SEC61B Antibody [NBP2-13290] - Staining of human duodenum shows moderate to strong positivity in endoplasmic reticulum in glandular cells.
Immunohistochemistry-Paraffin: SEC61B Antibody [NBP2-13290]

Immunohistochemistry-Paraffin: SEC61B Antibody [NBP2-13290]

Immunohistochemistry-Paraffin: SEC61B Antibody [NBP2-13290] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Applications for SEC61B Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SEC61B

The SEC61 complex is the central component of the protein translocation apparatus of the endoplasmic reticulum (ER) membrane. Oligomers of the SEC61 complex form a transmembrane channel where proteins are translocated across and integrated into the ER membrane. This complex consists of three membrane proteins alpha, beta, and gamma. This gene encodes the beta subunit protein. The SEC61 subunits are also observed in the post ER compartment, suggesting that these proteins can escape the ER and recycle back. There is evidence for multiple polyadenylated sites for this transcript.

Alternate Names

protein translocation complex beta, protein transport protein SEC61 beta subunit, protein transport protein Sec61 subunit beta, Sec61 beta subunit, Sec61 complex, beta subunit, SEC61B

Gene Symbol

SEC61B

Additional SEC61B Products

Product Documents for SEC61B Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SEC61B Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for SEC61B Antibody - BSA Free

Customer Reviews for SEC61B Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SEC61B Antibody - BSA Free and earn rewards!

Have you used SEC61B Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...