SERCA2 ATPase Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59203

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Monkey

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SERCA2 ATPase Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to ATP2A2(ATPase, Ca++ transporting, cardiac muscle, slow twitch 2) The peptide sequence was selected from the C terminal of ATP2A2. Peptide sequence VNLVTDGLPATALGFNPPDLDIMNKPPRNPKEPLISGWLFFRYLAIGCYV. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

115 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for SERCA2 ATPase Antibody - BSA Free

Western Blot: SERCA2 ATPase Antibody [NBP1-59203]

Western Blot: SERCA2 ATPase Antibody [NBP1-59203]

SERCA2-ATPase-Antibody-Western-Blot-NBP1-59203-img0006.jpg
Immunohistochemistry: SERCA2 ATPase Antibody [NBP1-59203]

Immunohistochemistry: SERCA2 ATPase Antibody [NBP1-59203]

Immunohistochemistry: SERCA2 ATPase Antibody [NBP1-59203] - Rhesus macaque spinal cord Primary Antibody Dilution: 1 : 300 Secondary Antibody: Donkey anti Rabbit 488 Secondary Antibody Dilution: 1 : 500Color/Signal Descriptions: Green: ATP2A2 Gene name: APLP2 Submitted by: Timur Mavlyutov, Ph. D., Department of Pharmacology, University of Wisconsin Medical School, 1300 University Avenue, Madison, WI 53706.
Western Blot: SERCA2 ATPase Antibody [NBP1-59203]

Western Blot: SERCA2 ATPase Antibody [NBP1-59203]

Western Blot: SERCA2 ATPase Antibody [NBP1-59203] - Human MCF-7. Titration: 0.2-1 ug/ml, Positive Control: MCF7 cell lysate.

Applications for SERCA2 ATPase Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SERCA2 ATPase

ATP2A2 is one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol into the sarcoplasmic reticulum lumen, and is involved in regulation of the contraction/relaxation cycle. Mutations in this gene cause Darier-White disease, also known as keratosis follicularis, an autosomal dominant skin disorder characterized by loss of adhesion between epidermal cells and abnormal keratinization. Alternative splicing results in multiple transcript variants encoding different isoforms.This gene encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen, and is involved in regulation of the contraction/relaxation cycle. Mutations in this gene cause Darier-White disease, also known as keratosis follicularis, an autosomal dominant skin disorder characterized by loss of adhesion between epidermal cells and abnormal keratinization. Alternative splicing results in two transcript variants encoding different isoforms.

Long Name

Sarcoplasmic/endoplasmic reticulum calcium ATPase 2

Alternate Names

ATP2A2, ATP2B, Calcium pump 2, SERCA2, SR Ca(2+)-ATPase 2

Gene Symbol

ATP2A2

UniProt

P16615 (Human)

Additional SERCA2 ATPase Products

Product Documents for SERCA2 ATPase Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SERCA2 ATPase Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for SERCA2 ATPase Antibody - BSA Free

Customer Reviews for SERCA2 ATPase Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SERCA2 ATPase Antibody - BSA Free and earn rewards!

Have you used SERCA2 ATPase Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies