Serpin A5/Protein C Inhibitor Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-17021

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: KWETSFNHKGTQEQDFYVTSETVVRVPMMSREDQYHYLLDRNLSCRVVGVPYQGNAT

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Serpin A5/Protein C Inhibitor Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Serpin A5/Protein C Inhibitor Antibody [NBP3-17021]

Immunocytochemistry/ Immunofluorescence: Serpin A5/Protein C Inhibitor Antibody [NBP3-17021]

Immunocytochemistry/Immunofluorescence: Serpin A5/Protein C Inhibitor Antibody [NBP3-17021] - Analysis in human testis and cerebral cortex tissues using Anti-SERPINA5 antibody. Corresponding SERPINA5 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Serpin A5/Protein C Inhibitor Antibody [NBP3-17021]

Immunohistochemistry-Paraffin: Serpin A5/Protein C Inhibitor Antibody [NBP3-17021]

Immunohistochemistry-Paraffin: Serpin A5/Protein C Inhibitor Antibody [NBP3-17021] - Staining of human cerebral cortex shows low expression as expected.
Immunohistochemistry-Paraffin: Serpin A5/Protein C Inhibitor Antibody [NBP3-17021]

Immunohistochemistry-Paraffin: Serpin A5/Protein C Inhibitor Antibody [NBP3-17021]

Immunohistochemistry-Paraffin: Serpin A5/Protein C Inhibitor Antibody [NBP3-17021] - Staining of human testis shows high expression.

Applications for Serpin A5/Protein C Inhibitor Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Serpin A5/Protein C Inhibitor

PAI-1, PAI-2 and PAI-3 (plasminogen activator inhibitor-1, -2 and -3) are members of the serpin serine proteinase inhibitor family. PAI-1 and PAI-2 regulate uPA (urokinase-type plasminogen activator) and TPA (tissue plasminogen activator), resulting in the inhibition of proteolytic activity. Members of the serpin family generally complex with their target proteinases, then disassociate slowly into cleaved species that fold into stable inactive forms. PAI-1 can fold into the inactive state without cleavage resulting in the latent form of PAI-1. Activity can be restored to the latent form of PAI-1 through denaturation and renaturation. PAI-2 occurs in secreted and cytosolic forms through facultative polypeptide translocation. PAI-3 inhibits plasminogen activators as well as activated protein C. PAI-3 is secreted in plasma, but is also expressed in liver.

Alternate Names

PAI-3, PCI

Gene Symbol

SERPINA5

Additional Serpin A5/Protein C Inhibitor Products

Product Documents for Serpin A5/Protein C Inhibitor Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Serpin A5/Protein C Inhibitor Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Serpin A5/Protein C Inhibitor Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Serpin A5/Protein C Inhibitor Antibody - BSA Free and earn rewards!

Have you used Serpin A5/Protein C Inhibitor Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...

Associated Pathways

Blood Coagulation Signaling Pathways Blood Coagulation Signaling Pathway Thumbnail