Serpin C1/Antithrombin-III Antibody (2X2V4)

Novus Biologicals | Catalog # NBP3-15363

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 2X2V4 expressed in HEK293
View all Serpin C1/Antithrombin-III Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Serpin C1/Antithrombin-III (P01008). MYSNVIGTVTSGKRKVYLLSLLLIGFWDCVTCHGSPVDICTAKPRDIPMNPMCIYRSPEKKATEDEGSEQKIPEATNRRVWELSKANSRFATTFYQHLAD

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit Serpin C1/Antithrombin-III Antibody (2X2V4) (NBP3-15363) is a recombinant monoclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for Serpin C1/Antithrombin-III Antibody (2X2V4)

Western Blot: Serpin C1/Antithrombin-III Antibody (2X2V4) [NBP3-15363]

Western Blot: Serpin C1/Antithrombin-III Antibody (2X2V4) [NBP3-15363]

Western Blot: Serpin C1/Antithrombin-III Antibody (2X2V4) [NBP3-15363] - Western blot analysis of extracts of various cell lines, using Serpin C1/Antithrombin-III Rabbit mAb (NBP3-15363) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.
Immunohistochemistry-Paraffin: Serpin C1/Antithrombin-III Antibody (2X2V4) [NBP3-15363]

Immunohistochemistry-Paraffin: Serpin C1/Antithrombin-III Antibody (2X2V4) [NBP3-15363]

Immunohistochemistry-Paraffin: Serpin C1/Antithrombin-III Antibody (2X2V4) [NBP3-15363] - Immunohistochemistry of paraffin-embedded human liver using Serpin C1/Antithrombin-III Rabbit mAb (NBP3-15363) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Western Blot: Serpin C1/Antithrombin-III Antibody (2X2V4) [NBP3-15363]

Western Blot: Serpin C1/Antithrombin-III Antibody (2X2V4) [NBP3-15363]

Western Blot: Serpin C1/Antithrombin-III Antibody (2X2V4) [NBP3-15363] - Western blot analysis of extracts of various cell lines, using Serpin C1/Antithrombin-III Rabbit mAb (NBP3-15363) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.

Applications for Serpin C1/Antithrombin-III Antibody (2X2V4)

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Serpin C1/Antithrombin-III

Antithrombin III (ATH III) is a plasma protein synthesised in the liver. Normal plasma levels are 115 to 160mg/L. ATH III consists of a single polypeptide chain and has a molecular weight of 58kDa. ATH III is a serine protease inhibitor and regulates coagulation by the formation of covalently liked complexes. ATH III also has a heparin binding site and in the presence of heparin the inhibition of thrombin, factors IXa, Xa and XIa is enhanced 1000 fold. Low levels of ATH III (functional or concentration) are associated with deep vein thrombosis and pulmonary embolism. Antithrombin assays are based on immunologic, enzymatic, or clotting properties

Alternate Names

Antithrombin-III, ATIII

Gene Symbol

SERPINC1

Additional Serpin C1/Antithrombin-III Products

Product Documents for Serpin C1/Antithrombin-III Antibody (2X2V4)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Serpin C1/Antithrombin-III Antibody (2X2V4)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Serpin C1/Antithrombin-III Antibody (2X2V4)

There are currently no reviews for this product. Be the first to review Serpin C1/Antithrombin-III Antibody (2X2V4) and earn rewards!

Have you used Serpin C1/Antithrombin-III Antibody (2X2V4)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies

Associated Pathways

Blood Coagulation Signaling Pathways Blood Coagulation Signaling Pathway Thumbnail