![Western Blot: SET Antibody [NBP2-38031]](https://beta-resources.rndsystems.com/images/products/SET-Antibody-Western-Blot-NBP2-38031-img0003.jpg "Western Blot: SET Antibody [NBP2-38031]")
Loading...
Key Product Details
Species Reactivity
Human
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: MAPKRQSPLPPQKKKPRPPPALGPEETSASAGLPKKGEKEQQEAIEHIDEVQNEID
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Description
Novus Biologicals Rabbit SET Antibody - BSA Free (NBP2-38031) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
Scientific Data Images for SET Antibody - BSA Free
Western Blot: SET Antibody [NBP2-38031]
Western Blot: SET Antibody [NBP2-38031] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Liver tissue
![Immunocytochemistry/ Immunofluorescence: SET Antibody [NBP2-38031]](https://beta-resources.rndsystems.com/images/products/SET-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38031-img0004.jpg "Immunocytochemistry/ Immunofluorescence: SET Antibody [NBP2-38031]")
Immunocytochemistry/ Immunofluorescence: SET Antibody [NBP2-38031]
Immunocytochemistry/Immunofluorescence: SET Antibody [NBP2-38031] - Staining of human cell line SiHa shows localization to nucleoplasm. Antibody staining is shown in green.![Immunohistochemistry-Paraffin: SET Antibody [NBP2-38031]](https://beta-resources.rndsystems.com/images/products/SET-Antibody-Immunohistochemistry-Paraffin-NBP2-38031-img0008.jpg "Immunohistochemistry-Paraffin: SET Antibody [NBP2-38031]")
Immunohistochemistry-Paraffin: SET Antibody [NBP2-38031]
Immunohistochemistry-Paraffin: SET Antibody [NBP2-38031] - Staining of human lymph node shows very strong nuclear positivity in non-germinal center cells.![Immunohistochemistry-Paraffin: SET Antibody [NBP2-38031]](https://beta-resources.rndsystems.com/images/products/SET-Antibody-Immunohistochemistry-Paraffin-NBP2-38031-img0005.jpg "Immunohistochemistry-Paraffin: SET Antibody [NBP2-38031]")
Immunohistochemistry-Paraffin: SET Antibody [NBP2-38031]
Immunohistochemistry-Paraffin: SET Antibody [NBP2-38031] - Staining of human cerebral cortex shows moderate nuclear positivity in neurons.![Immunohistochemistry-Paraffin: SET Antibody [NBP2-38031]](https://beta-resources.rndsystems.com/images/products/SET-Antibody-Immunohistochemistry-Paraffin-NBP2-38031-img0006.jpg "Immunohistochemistry-Paraffin: SET Antibody [NBP2-38031]")
Immunohistochemistry-Paraffin: SET Antibody [NBP2-38031]
Immunohistochemistry-Paraffin: SET Antibody [NBP2-38031] - Staining of human colon shows very strong nuclear positivity in glandular cells.![Immunohistochemistry-Paraffin: SET Antibody [NBP2-38031]](https://beta-resources.rndsystems.com/images/products/SET-Antibody-Immunohistochemistry-Paraffin-NBP2-38031-img0007.jpg "Immunohistochemistry-Paraffin: SET Antibody [NBP2-38031]")
Immunohistochemistry-Paraffin: SET Antibody [NBP2-38031]
Immunohistochemistry-Paraffin: SET Antibody [NBP2-38031] - Staining of human kidney shows strong nuclear positivity in cells in tubules.Applications for SET Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:1000 - 1:2500
Immunohistochemistry-Paraffin
1:1000 - 1:2500
Western Blot
0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: SET
Alternate Names
2PP2A, HLA-DR-associated protein II, I2PP2A, I-2PP2A, IGAAD, Inhibitor of granzyme A-activated DNase, inhibitor-2 of protein phosphatase-2A, IPP2A2, PHAPIITAF-I, Phosphatase 2A inhibitor I2PP2A, protein phosphatase type 2A inhibitor, protein SET, SET nuclear oncogene, SET translocation (myeloid leukemia-associated), TAF-IBETA, Template-activating factor I, Template-Activating Factor-I, chromatin remodelling factor
Gene Symbol
SET
UniProt
Additional SET Products
Product Documents for SET Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for SET Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for SET Antibody - BSA Free
There are currently no reviews for this product. Be the first to review SET Antibody - BSA Free and earn rewards!
Have you used SET Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...