SFXN2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-85960

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: PMMRQQELIKGICVKDRNENEIGHSRRAAAIGITQ

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SFXN2 Antibody - BSA Free

Staining of human rectum shows moderate cytoplasmic positivity in glandular cells.

Staining of human rectum shows moderate cytoplasmic positivity in glandular cells.

Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Staining of human placenta shows moderate positivity in trophoblastic cells.

Staining of human placenta shows moderate positivity in trophoblastic cells.
SFXN2 Antibody - BSA Free Immunohistochemistry-Paraffin: SFXN2 Antibody - BSA Free [NBP1-85960]

Immunohistochemistry-Paraffin: SFXN2 Antibody - BSA Free [NBP1-85960]

Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
SFXN2 Antibody - BSA Free Immunocytochemistry/ Immunofluorescence: SFXN2 Antibody - BSA Free [NBP1-85960]

Immunocytochemistry/ Immunofluorescence: SFXN2 Antibody - BSA Free [NBP1-85960]

Staining of human cell line U-2 OS shows localization to mitochondria.
SFXN2 Antibody - BSA Free Western Blot: SFXN2 Antibody - BSA Free [NBP1-85960]

Western Blot: SFXN2 Antibody - BSA Free [NBP1-85960]

Analysis in control (vector only transfected HEK293T lysate) and SFXN2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).
SFXN2 Antibody - BSA Free

Western Blot: SFXN2 Antibody - BSA Free [NBP1-85960] -

Parkin mediates SFXN2 degradation through K48-linked polyubiquitination (A,B) Western blot (WB) analysis of SFXN2, Parkin, and Ubiquitin protein levels in HEK293 cells expressing Parkin-Myc, SFXN2-HA, and Ubiquitin variant (control vector, HA-Ub-WT, HA-Ub-K48, HA-Ub-K48R, or HA-Ub-KR). Anti-alpha -Tubulin was used as the loading control for the immunoblotting (IB, A). Quantification of relative SFXN2 protein levels normalized to alpha -Tubulin is presented in the histogram (B). (C,D) WB analysis of SFXN2, Parkin, and Ubiquitin protein levels in HEK293 cells expressing Parkin-Myc, SFXN2-HA, and Ubiquitin variant (control vector, HA-Ub-WT, HA-Ub-K63, HA-Ub-K63R, or HA-Ub-KR). Anti-alpha -Tubulin was used as the loading control for the IB (C), Quantification of relative SFXN2 protein levels normalized to alpha -Tubulin is presented in the histogram (D). Images are representative of at least three independent experiments that gave similar results. Histogram data are presented as mean +/- SEM (N = 3). Statistical significance was analyzed using one way ANOVA. *p < 0.05, **p < 0.01, ***p < 0.001, ns, non-significant. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/40894005), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
SFXN2 Antibody - BSA Free

Western Blot: SFXN2 Antibody - BSA Free [NBP1-85960] -

Parkin negatively regulates SFXN2 protein levels in cells (A,B) Western blot (WB) analysis of SFXN2 and Parkin protein levels in HEK293 cells transfected with scrambled siRNA or siRNA targeting Parkin (A). Quantification of relative SFXN2 protein levels normalized to alpha -Tubulin is presented in the histogram (B). (C,D) WB analysis of SFXN2 and Parkin protein levels in HEK293 cells overexpressing Parkin-Myc or control vector (C). Quantification of relative SFXN2 protein levels normalized to alpha -Tubulin is presented in the histogram (D). (E,F) WB analysis of endogenous SFXN2 and Parkin protein levels in HEK293 cells overexpressing control vector or Parkin-Myc (E), with or without 10 μM MG132 treatment for 8 h before harvest. Quantification of relative SFXN2 protein levels normalized to alpha -Tubulin is presented in the histogram (F). (G,H) WB analysis of SFXN2 and Parkin protein levels in HEK293 cells overexpressing SFXN2-HA alone or Parkin-Myc plus SFXN2-HA (G), with or without 10 μM MG132 treatment for 8 h before harvest. Quantification of relative SFXN2 protein levels normalized to alpha -Tubulin is presented in the histogram (H). (I,J) WB analysis of SFXN2 and Parkin protein levels in HEK293 cells expressing SFXN2-HA and Parkin variant (control vector, Parkin-WT, Pakin-T240R, or Parkin-R42P). Anti-alpha -Tubulin was used as the loading control for the IB. Quantification of relative SFXN2 protein levels normalized to alpha -Tubulin is presented in the histogram (J). Images are representative of at least three independent experiments that gave similar results. Histogram data are presented as mean +/- SEM (N = 3). Statistical significance was analyzed using one-way ANOVA and two-way ANOVA. *p < 0.05, **p < 0.01, ***p < 0.001, ns, non-significant. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/40894005), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
SFXN2 Antibody - BSA Free

Western Blot: SFXN2 Antibody - BSA Free [NBP1-85960] -

Parkin negatively regulates SFXN2 protein levels in cells (A,B) Western blot (WB) analysis of SFXN2 and Parkin protein levels in HEK293 cells transfected with scrambled siRNA or siRNA targeting Parkin (A). Quantification of relative SFXN2 protein levels normalized to alpha -Tubulin is presented in the histogram (B). (C,D) WB analysis of SFXN2 and Parkin protein levels in HEK293 cells overexpressing Parkin-Myc or control vector (C). Quantification of relative SFXN2 protein levels normalized to alpha -Tubulin is presented in the histogram (D). (E,F) WB analysis of endogenous SFXN2 and Parkin protein levels in HEK293 cells overexpressing control vector or Parkin-Myc (E), with or without 10 μM MG132 treatment for 8 h before harvest. Quantification of relative SFXN2 protein levels normalized to alpha -Tubulin is presented in the histogram (F). (G,H) WB analysis of SFXN2 and Parkin protein levels in HEK293 cells overexpressing SFXN2-HA alone or Parkin-Myc plus SFXN2-HA (G), with or without 10 μM MG132 treatment for 8 h before harvest. Quantification of relative SFXN2 protein levels normalized to alpha -Tubulin is presented in the histogram (H). (I,J) WB analysis of SFXN2 and Parkin protein levels in HEK293 cells expressing SFXN2-HA and Parkin variant (control vector, Parkin-WT, Pakin-T240R, or Parkin-R42P). Anti-alpha -Tubulin was used as the loading control for the IB. Quantification of relative SFXN2 protein levels normalized to alpha -Tubulin is presented in the histogram (J). Images are representative of at least three independent experiments that gave similar results. Histogram data are presented as mean +/- SEM (N = 3). Statistical significance was analyzed using one-way ANOVA and two-way ANOVA. *p < 0.05, **p < 0.01, ***p < 0.001, ns, non-significant. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/40894005), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
SFXN2 Antibody - BSA Free

Western Blot: SFXN2 Antibody - BSA Free [NBP1-85960] -

Parkin negatively regulates SFXN2 protein levels in cells (A,B) Western blot (WB) analysis of SFXN2 and Parkin protein levels in HEK293 cells transfected with scrambled siRNA or siRNA targeting Parkin (A). Quantification of relative SFXN2 protein levels normalized to alpha -Tubulin is presented in the histogram (B). (C,D) WB analysis of SFXN2 and Parkin protein levels in HEK293 cells overexpressing Parkin-Myc or control vector (C). Quantification of relative SFXN2 protein levels normalized to alpha -Tubulin is presented in the histogram (D). (E,F) WB analysis of endogenous SFXN2 and Parkin protein levels in HEK293 cells overexpressing control vector or Parkin-Myc (E), with or without 10 μM MG132 treatment for 8 h before harvest. Quantification of relative SFXN2 protein levels normalized to alpha -Tubulin is presented in the histogram (F). (G,H) WB analysis of SFXN2 and Parkin protein levels in HEK293 cells overexpressing SFXN2-HA alone or Parkin-Myc plus SFXN2-HA (G), with or without 10 μM MG132 treatment for 8 h before harvest. Quantification of relative SFXN2 protein levels normalized to alpha -Tubulin is presented in the histogram (H). (I,J) WB analysis of SFXN2 and Parkin protein levels in HEK293 cells expressing SFXN2-HA and Parkin variant (control vector, Parkin-WT, Pakin-T240R, or Parkin-R42P). Anti-alpha -Tubulin was used as the loading control for the IB. Quantification of relative SFXN2 protein levels normalized to alpha -Tubulin is presented in the histogram (J). Images are representative of at least three independent experiments that gave similar results. Histogram data are presented as mean +/- SEM (N = 3). Statistical significance was analyzed using one-way ANOVA and two-way ANOVA. *p < 0.05, **p < 0.01, ***p < 0.001, ns, non-significant. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/40894005), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
SFXN2 Antibody - BSA Free

Western Blot: SFXN2 Antibody - BSA Free [NBP1-85960] -

Mitochondrial impairment decreases SFXN2 levels (A,B) Western blot (WB) analysis of SFXN2 and PINK1 protein levels in HEK293 cells treated with 20 μM CCCP for the indicated time periods (A). Quantification of relative SFXN2 protein levels normalized to alpha -Tubulin is presented in the histogram (B). (C,D) WB analysis of SFXN2 and Cytochrome C (Cyt C) protein levels in HEK293 cells treated with the indicated concentrations of MPP+ for 24 h (C). Quantification of relative SFXN2 protein levels normalized to alpha -Tubulin is presented in the histogram (D). (E,F) WB analysis of SFXN2 and PINK1 protein levels in HEK293 cells treated with vehicle control (0.05% (v/v) DMSO), CCCP (10 μM) alone, or CCCP (10 μM) combined with MG132 (10 μM) for 12 h (E). Quantification of relative SFXN2 protein levels normalized to actin is presented in the histogram (F). Images are representative of at least three independent experiments with similar results. Histogram data are presented as mean +/- SEM (N = 3). Statistical significance was analyzed using one-way ANOVA. *p < 0.05, **p < 0.01, ***p < 0.001. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/40894005), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
SFXN2 Antibody - BSA Free

Western Blot: SFXN2 Antibody - BSA Free [NBP1-85960] -

Mitochondrial impairment decreases SFXN2 levels (A,B) Western blot (WB) analysis of SFXN2 and PINK1 protein levels in HEK293 cells treated with 20 μM CCCP for the indicated time periods (A). Quantification of relative SFXN2 protein levels normalized to alpha -Tubulin is presented in the histogram (B). (C,D) WB analysis of SFXN2 and Cytochrome C (Cyt C) protein levels in HEK293 cells treated with the indicated concentrations of MPP+ for 24 h (C). Quantification of relative SFXN2 protein levels normalized to alpha -Tubulin is presented in the histogram (D). (E,F) WB analysis of SFXN2 and PINK1 protein levels in HEK293 cells treated with vehicle control (0.05% (v/v) DMSO), CCCP (10 μM) alone, or CCCP (10 μM) combined with MG132 (10 μM) for 12 h (E). Quantification of relative SFXN2 protein levels normalized to actin is presented in the histogram (F). Images are representative of at least three independent experiments with similar results. Histogram data are presented as mean +/- SEM (N = 3). Statistical significance was analyzed using one-way ANOVA. *p < 0.05, **p < 0.01, ***p < 0.001. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/40894005), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
SFXN2 Antibody - BSA Free

Western Blot: SFXN2 Antibody - BSA Free [NBP1-85960] -

Parkin mediates SFXN2 degradation through K48-linked polyubiquitination (A,B) Western blot (WB) analysis of SFXN2, Parkin, and Ubiquitin protein levels in HEK293 cells expressing Parkin-Myc, SFXN2-HA, and Ubiquitin variant (control vector, HA-Ub-WT, HA-Ub-K48, HA-Ub-K48R, or HA-Ub-KR). Anti-alpha -Tubulin was used as the loading control for the immunoblotting (IB, A). Quantification of relative SFXN2 protein levels normalized to alpha -Tubulin is presented in the histogram (B). (C,D) WB analysis of SFXN2, Parkin, and Ubiquitin protein levels in HEK293 cells expressing Parkin-Myc, SFXN2-HA, and Ubiquitin variant (control vector, HA-Ub-WT, HA-Ub-K63, HA-Ub-K63R, or HA-Ub-KR). Anti-alpha -Tubulin was used as the loading control for the IB (C), Quantification of relative SFXN2 protein levels normalized to alpha -Tubulin is presented in the histogram (D). Images are representative of at least three independent experiments that gave similar results. Histogram data are presented as mean +/- SEM (N = 3). Statistical significance was analyzed using one way ANOVA. *p < 0.05, **p < 0.01, ***p < 0.001, ns, non-significant. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/40894005), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for SFXN2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SFXN2

Potential iron transporter

Alternate Names

sideroflexin 2, sideroflexin-2

Gene Symbol

SFXN2

Additional SFXN2 Products

Product Documents for SFXN2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SFXN2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for SFXN2 Antibody - BSA Free

Customer Reviews for SFXN2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SFXN2 Antibody - BSA Free and earn rewards!

Have you used SFXN2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...