SH3PX1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-58144

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Rat (91%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SH3PX1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RVMYDFAAEPGNNELTVNEGEIITITNPDVGGGWLEGRNIKGERGLVPTDYVEILPSDGKDQFSCGNSVA

Reactivity Notes

Mouse 89%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SH3PX1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: SH3PX1 Antibody [NBP2-58144]

Immunocytochemistry/ Immunofluorescence: SH3PX1 Antibody [NBP2-58144]

Immunocytochemistry/Immunofluorescence: SH3PX1 Antibody [NBP2-58144] - Staining of human cell line U-251 MG shows localization to plasma membrane & cytosol.

Applications for SH3PX1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SH3PX1

The SH3PX1 (SNX1) gene is part of the sorting nexin family, thus plays a role in several states of intracellular trafficking. There is only one isoform at 595 amino acids long and at a mass of around 66 kDA. The SH3PX1 gene has been linked to choanal atresia, alcoholism, asthma, rabies, neuronitis, and wiskitt-aldrich syndrome. It is involved in clathrin derived and trans-Golgi network vesicle budding as well as membrane trafficking through interactions with other genes such as ITCH, DNM2, SYNJ1, ASAP1, and ADAM15.

Alternate Names

MST155, MSTP155, Protein SDP1, SDP1, SH3 and PX domain-containing protein 1, SH3PX1WISP, SH3PXD3ASH3 and PX domain-containing protein SH3PX1, sorting nexin 9, sorting nexin-9, WiskSH3 and PX domain-containing protein 3A

Gene Symbol

SNX9

Additional SH3PX1 Products

Product Documents for SH3PX1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SH3PX1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SH3PX1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SH3PX1 Antibody - BSA Free and earn rewards!

Have you used SH3PX1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies