Signal Peptide Peptidase Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-54935

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Rat (90%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Signal Peptide Peptidase Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KGEVTEMFSYEESNPKDPAAVTESKEGTEASASKGLEKKEK

Reactivity Notes

Mouse 88%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Signal Peptide Peptidase Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Signal Peptide Peptidase Antibody [NBP2-54935]

Immunocytochemistry/ Immunofluorescence: Signal Peptide Peptidase Antibody [NBP2-54935]

Immunocytochemistry/Immunofluorescence: Signal Peptide Peptidase Antibody [NBP2-54935] - Staining of human cell line U-2 OS shows localization to endoplasmic reticulum.

Applications for Signal Peptide Peptidase Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Signal Peptide Peptidase

Signal Peptide Peptidase is encoded by this gene, which localizes to the endoplasmic reticulum, catalyzes intramembrane proteolysis of some signal peptides after they have been cleaved from a preprotein. This activity is required to generate signal sequence-derived human lymphocyte antigen-E epitopes that are recognized by the immune system, and to process hepatitis C virus core protein. The encoded protein is an integral membrane protein with sequence motifs characteristic of the presenilin-type aspartic proteases. Multiple transcript variants encoding several different isoforms have been found for this gene. [provided by RefSeq]

Alternate Names

dJ324O17.1, EC 3.4.23.-, H13hIMP1, histocompatibility (minor) 13, IMP-1, IMP1MSTP086, Intramembrane protease 1, minor histocompatibility antigen 13, minor histocompatibility antigen H13, Presenilin-like protein 3, PSENL3, PSL3IMPAS, Signal peptide peptidase, signal peptide peptidase beta, SPPIMPAS-1

Gene Symbol

HM13

Additional Signal Peptide Peptidase Products

Product Documents for Signal Peptide Peptidase Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Signal Peptide Peptidase Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Signal Peptide Peptidase Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Signal Peptide Peptidase Antibody - BSA Free and earn rewards!

Have you used Signal Peptide Peptidase Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies