SIN3A Antibody (1Z7Y1)

Novus Biologicals | Catalog # NBP3-33359

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Rabbit IgG Clone # 1Z7Y1
View all SIN3A Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SIN3A (NP_056292.1).

Sequence:
MKRRLDDQESPVYAAQQRRIPGSTEAFPHQHRVLAPAPPVYEAVSETMQSATGIQYSVTPSYQVSAMPQSSGSHGPAIAAVHSSHHHPTAVQPHGGQVVQ

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

145 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for SIN3A Antibody (1Z7Y1)

SIN3A Antibody (1Z7Y1)

Western Blot: SIN3A Antibody (1Z7Y1) [NBP3-33359] -

Western Blot: SIN3A Antibody (1Z7Y1) [NBP3-33359] - Western blot analysis of various lysates, using SIN3A Rabbit mAb at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 90s.

Applications for SIN3A Antibody (1Z7Y1)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Western Blot

1:1000 - 1:5000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: SIN3A

Sin3A is encoded by this gene is a transcriptional regulatory protein. It contains paired amphipathic helix (PAH) domains, which are important for protein-protein interactions and may mediate repression by the Mad-Max complex.

Long Name

SIN3 Homolog A

Alternate Names

DKFZp434K2235, FLJ90319, Histone deacetylase complex subunit Sin3a, KIAA0700, paired amphipathic helix protein Sin3a, SIN3 homolog A, transcription regulator (yeast), SIN3 homolog A, transcriptional regulator (yeast), Transcriptional corepressor Sin3a, transcriptional co-repressor Sin3A, transcriptional regulator, SIN3A

Gene Symbol

SIN3A

Additional SIN3A Products

Product Documents for SIN3A Antibody (1Z7Y1)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SIN3A Antibody (1Z7Y1)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SIN3A Antibody (1Z7Y1)

There are currently no reviews for this product. Be the first to review SIN3A Antibody (1Z7Y1) and earn rewards!

Have you used SIN3A Antibody (1Z7Y1)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies