Sirtuin 5/SIRT5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-86013

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Cited:

Human

Predicted:

Mouse (92%), Rat (92%). Backed by our 100% Guarantee.

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Sirtuin 5/SIRT5 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: AILEEVDRELAHCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTPATNRFRFHFQGPCGTTLPEAL

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 26658802).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Sirtuin 5/SIRT5 Antibody - BSA Free

Immunohistochemistry-Paraffin: Sirtuin 5/SIRT5 Antibody [NBP1-86013]

Immunohistochemistry-Paraffin: Sirtuin 5/SIRT5 Antibody [NBP1-86013]

Immunohistochemistry-Paraffin: Sirtuin 5/SIRT5 Antibody [NBP1-86013] - Staining of human Stomach shows moderate granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Sirtuin 5/SIRT5 Antibody [NBP1-86013]

Immunohistochemistry-Paraffin: Sirtuin 5/SIRT5 Antibody [NBP1-86013]

Immunohistochemistry-Paraffin: Sirtuin 5/SIRT5 Antibody [NBP1-86013] - Staining of human heart muscle shows moderate to strong granular cytoplasmic positivity.
Immunohistochemistry-Paraffin: Sirtuin 5/SIRT5 Antibody [NBP1-86013]

Immunohistochemistry-Paraffin: Sirtuin 5/SIRT5 Antibody [NBP1-86013]

Immunohistochemistry-Paraffin: Sirtuin 5/SIRT5 Antibody [NBP1-86013] - Staining of human kidney shows moderate to strong granular cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: Sirtuin 5/SIRT5 Antibody [NBP1-86013]

Immunohistochemistry-Paraffin: Sirtuin 5/SIRT5 Antibody [NBP1-86013]

Immunohistochemistry-Paraffin: Sirtuin 5/SIRT5 Antibody [NBP1-86013] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: Sirtuin 5/SIRT5 Antibody [NBP1-86013]

Immunohistochemistry-Paraffin: Sirtuin 5/SIRT5 Antibody [NBP1-86013]

Immunohistochemistry-Paraffin: Sirtuin 5/SIRT5 Antibody [NBP1-86013] - Analysis in human heart muscle and pancreas tissues using NBP1-86013 antibody. Corresponding SIRT5 RNA-seq data are presented for the same tissues.
Sirtuin 5/SIRT5 Antibody - BSA Free Western Blot: Sirtuin 5/SIRT5 Antibody - BSA Free [NBP1-86013]

Western Blot: Sirtuin 5/SIRT5 Antibody - BSA Free [NBP1-86013]

Analysis in control (vector only transfected HEK293T lysate) and SIRT5 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

Applications for Sirtuin 5/SIRT5 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50

Western Blot

0.04-0.4 ug/ml
Application Notes
WB reported in scientific literature (PMID: 26658802). For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Sirtuin 5/SIRT5

SIRT5 encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by this gene is included in class III of the sirtuin family. Alternative splicing of this gene results in two transcript variants.

Long Name

Silent Mating Type Information Regulation 5 Homolog

Alternate Names

SIR2L5, SIRT5

Gene Symbol

SIRT5

Additional Sirtuin 5/SIRT5 Products

Product Documents for Sirtuin 5/SIRT5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Sirtuin 5/SIRT5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Epigenetics

Citations for Sirtuin 5/SIRT5 Antibody - BSA Free

Customer Reviews for Sirtuin 5/SIRT5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Sirtuin 5/SIRT5 Antibody - BSA Free and earn rewards!

Have you used Sirtuin 5/SIRT5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies