SIX1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-82401

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SIX1 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptide towards Six1. Peptide sequence ERLGRFLWSLPACDHLHKNESVLKAKAVVAFHRGNFRELYKILESHQFSP. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for SIX1 Antibody - BSA Free

Western Blot: SIX1 Antibody [NBP1-82401]

Western Blot: SIX1 Antibody [NBP1-82401]

Western Blot: SIX1 Antibody [NBP1-82401] - Mouse Kidney Lysate 1ug/ml Gel Concentration 12%
Immunohistochemistry: SIX1 Antibody [NBP1-82401]

Immunohistochemistry: SIX1 Antibody [NBP1-82401]

Immunohistochemistry: SIX1 Antibody [NBP1-82401] - Human Adult heart Observed Staining: Cytoplasmic,Nuclear (very rare in Nuclear) Primary Antibody Concentration: 1 : 600 Secondary Antibody: Donkey anti-Rabbit-Cy2/3 Secondary Antibody Concentration: 1 : 200 Magnification: 20X Exposure Time: 0.5 2.0 secPro

Applications for SIX1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1 : 600

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SIX1

The protein encoded by the SIX1 gene is a homeobox protein that is similar to the Drosophila 'sine oculis' gene product. This gene is found in a cluster of related genes on chromosome 14 and is thought to be involved in limb development. Defects in this gene are a cause of autosomal dominant deafness type 23 (DFNA23) and branchiootic syndrome type 3 (BOS3). (provided by RefSeq)

Alternate Names

BOS3, deafness, autosomal dominant 23, DFNA23, homeobox protein SIX1, sine oculis homeobox (Drosophila) homolog 1, Sine oculis homeobox homolog 1, sine oculis homeobox homolog 1 (Drosophila), SIX homeobox 1, TIP39

Gene Symbol

SIX1

UniProt

NP_033215 (Mouse)

Additional SIX1 Products

Product Documents for SIX1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SIX1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SIX1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SIX1 Antibody - BSA Free and earn rewards!

Have you used SIX1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies