SLC22A12 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-82500

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SLC22A12 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: ESARWLLTTGRLDWGLQELWRVAAINGKGAVQDTLTPEVLLSAMREELSMGQPPASLGTLLRMPGLRFRTCI

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SLC22A12 Antibody - BSA Free

Immunohistochemistry-Paraffin: SLC22A12 Antibody [NBP1-82500]

Immunohistochemistry-Paraffin: SLC22A12 Antibody [NBP1-82500]

Immunohistochemistry-Paraffin: SLC22A12 Antibody [NBP1-82500] - Analysis in human kidney and testis tissues using NBP1-82500 antibody. Corresponding SLC22A12 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: SLC22A12 Antibody [NBP1-82500]

Immunohistochemistry-Paraffin: SLC22A12 Antibody [NBP1-82500]

Immunohistochemistry-Paraffin: SLC22A12 Antibody [NBP1-82500] - Staining of human testis shows no positivity in cells in seminiferous ducts as expected.
Immunohistochemistry-Paraffin: SLC22A12 Antibody [NBP1-82500]

Immunohistochemistry-Paraffin: SLC22A12 Antibody [NBP1-82500]

Immunohistochemistry-Paraffin: SLC22A12 Antibody [NBP1-82500] - Staining of human kidney shows high expression.
Immunohistochemistry-Paraffin: SLC22A12 Antibody [NBP1-82500]

Immunohistochemistry-Paraffin: SLC22A12 Antibody [NBP1-82500]

Immunohistochemistry-Paraffin: SLC22A12 Antibody [NBP1-82500] - Staining of human lymph node shows no positivity in lymphoid cells as expected.
Immunohistochemistry-Paraffin: SLC22A12 Antibody [NBP1-82500]

Immunohistochemistry-Paraffin: SLC22A12 Antibody [NBP1-82500]

Immunohistochemistry-Paraffin: SLC22A12 Antibody [NBP1-82500] - Staining of human liver shows no positivity in hepatocytes as expected.

Applications for SLC22A12 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SLC22A12

SLC22A12, also known as urate transporter 1 (URAT1), is a member of the organic cation/anion/zwitterion transporter family. This transporter is present on the epithelial cells of proximal tubules in the renal cortex and mediates urate uptake. Gene mutations or functional defects of URAT1 have been identified in patients with renal hypouricemia, which is characterized by low serum urate levels. Disorders associated with this condition include uric acid urolithiasis; hematuria; hypercalcemia; or occasionally, exercise-induced acute renal failure.

Long Name

Solute carrier family 22 member 12

Alternate Names

OATL4, RST, UNQ6453/PRO34004, URAT1

Gene Symbol

SLC22A12

Additional SLC22A12 Products

Product Documents for SLC22A12 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SLC22A12 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SLC22A12 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SLC22A12 Antibody - BSA Free and earn rewards!

Have you used SLC22A12 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies