SLC22A3 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-83976
Loading...
Key Product Details
Species Reactivity
Validated:
Human
Predicted:
Mouse (90%), Rat (90%). Backed by our 100% Guarantee.
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence
Cited:
Immunohistochemistry, Immunohistochemistry-Paraffin
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SPRWLITRKKGDKALQILRRIAKCNGKYLSSNYSEITVTDEEVSNPSF
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for SLC22A3 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence: SLC22A3 Antibody [NBP1-83976]
Immunocytochemistry/Immunofluorescence: SLC22A3 Antibody [NBP1-83976] - Immunofluorescent staining of human cell line A549 shows localization to cytosol & vesicles.Immunohistochemistry-Paraffin: SLC22A3 Antibody [NBP1-83976]
Immunohistochemistry-Paraffin: SLC22A3 Antibody [NBP1-83976] - Staining of human liver shows weak to moderate cytoplasmic positivity in hepatocytes.Immunohistochemistry-Paraffin: SLC22A3 Antibody [NBP1-83976]
Immunohistochemistry-Paraffin: SLC22A3 Antibody [NBP1-83976] - Staining of human prostate shows strong membranous positivity in glandular cells.Immunohistochemistry-Paraffin: SLC22A3 Antibody [NBP1-83976]
Immunohistochemistry-Paraffin: SLC22A3 Antibody [NBP1-83976] - Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.Immunohistochemistry-Paraffin: SLC22A3 Antibody [NBP1-83976]
Immunohistochemistry-Paraffin: SLC22A3 Antibody [NBP1-83976] - Staining of human fallopian tube shows moderate membranous and cytoplasmic positivity in glandular cells.Immunohistochemistry: SLC22A3 Antibody - BSA Free [NBP1-83976] -
IHC staining was used to validate single-nuclei RNA-seq data. a snRNA-seq harmony UMAP expression profile of endoneurial fibroblast marker LAMA2.b LAMA2 protein expression in 2 PN samples. c snRNA-seq harmony UMAP gene expression of perineurial fibroblast marker SLC22A. d SLC22A3 expression in 2 PN samples. e snRNA-seq UMAP expression of epineurial fibroblast marker PRRX1. f Representative H&E of classic PN morphology. f+ Zoomed in magnification of region of interest containing endoneurial, perineurial and epineurial zones. g PRRX1 protein expression in zoomed in region of interest. h SOX10 protein expression in same zoomed in region of interest. i snRNA-seq harmony UMAP expression profile of SOX10. j Representative H&E of second region of classic PN morphology in another patient. k SOX10 protein expression in region of interest Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/37770931), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Immunohistochemistry: SLC22A3 Antibody - BSA Free [NBP1-83976] -
IHC staining was used to validate single-nuclei RNA-seq data. a snRNA-seq harmony UMAP expression profile of endoneurial fibroblast marker LAMA2.b LAMA2 protein expression in 2 PN samples. c snRNA-seq harmony UMAP gene expression of perineurial fibroblast marker SLC22A. d SLC22A3 expression in 2 PN samples. e snRNA-seq UMAP expression of epineurial fibroblast marker PRRX1. f Representative H&E of classic PN morphology. f+ Zoomed in magnification of region of interest containing endoneurial, perineurial and epineurial zones. g PRRX1 protein expression in zoomed in region of interest. h SOX10 protein expression in same zoomed in region of interest. i snRNA-seq harmony UMAP expression profile of SOX10. j Representative H&E of second region of classic PN morphology in another patient. k SOX10 protein expression in region of interest Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/37770931), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for SLC22A3 Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:20 - 1:50
Immunohistochemistry-Paraffin
1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval method is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: SLC22A3
Long Name
Solute carrier family 22 member 3
Alternate Names
EMTH, OCT3
Entrez Gene IDs
6581 (Human)
Gene Symbol
SLC22A3
UniProt
Additional SLC22A3 Products
Product Documents for SLC22A3 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for SLC22A3 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for SLC22A3 Antibody - BSA Free
Customer Reviews for SLC22A3 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review SLC22A3 Antibody - BSA Free and earn rewards!
Have you used SLC22A3 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...