SLC22A3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-83976

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (90%), Rat (90%). Backed by our 100% Guarantee.

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Cited:

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: SPRWLITRKKGDKALQILRRIAKCNGKYLSSNYSEITVTDEEVSNPSF

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SLC22A3 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: SLC22A3 Antibody [NBP1-83976]

Immunocytochemistry/ Immunofluorescence: SLC22A3 Antibody [NBP1-83976]

Immunocytochemistry/Immunofluorescence: SLC22A3 Antibody [NBP1-83976] - Immunofluorescent staining of human cell line A549 shows localization to cytosol & vesicles.
Immunohistochemistry-Paraffin: SLC22A3 Antibody [NBP1-83976]

Immunohistochemistry-Paraffin: SLC22A3 Antibody [NBP1-83976]

Immunohistochemistry-Paraffin: SLC22A3 Antibody [NBP1-83976] - Staining of human liver shows weak to moderate cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: SLC22A3 Antibody [NBP1-83976]

Immunohistochemistry-Paraffin: SLC22A3 Antibody [NBP1-83976]

Immunohistochemistry-Paraffin: SLC22A3 Antibody [NBP1-83976] - Staining of human prostate shows strong membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: SLC22A3 Antibody [NBP1-83976]

Immunohistochemistry-Paraffin: SLC22A3 Antibody [NBP1-83976]

Immunohistochemistry-Paraffin: SLC22A3 Antibody [NBP1-83976] - Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.
Immunohistochemistry-Paraffin: SLC22A3 Antibody [NBP1-83976]

Immunohistochemistry-Paraffin: SLC22A3 Antibody [NBP1-83976]

Immunohistochemistry-Paraffin: SLC22A3 Antibody [NBP1-83976] - Staining of human fallopian tube shows moderate membranous and cytoplasmic positivity in glandular cells.
SLC22A3 Antibody - BSA Free

Immunohistochemistry: SLC22A3 Antibody - BSA Free [NBP1-83976] -

IHC staining was used to validate single-nuclei RNA-seq data. a snRNA-seq harmony UMAP expression profile of endoneurial fibroblast marker LAMA2.b LAMA2 protein expression in 2 PN samples. c snRNA-seq harmony UMAP gene expression of perineurial fibroblast marker SLC22A. d SLC22A3 expression in 2 PN samples. e snRNA-seq UMAP expression of epineurial fibroblast marker PRRX1. f Representative H&E of classic PN morphology. f+ Zoomed in magnification of region of interest containing endoneurial, perineurial and epineurial zones. g PRRX1 protein expression in zoomed in region of interest. h SOX10 protein expression in same zoomed in region of interest. i snRNA-seq harmony UMAP expression profile of SOX10. j Representative H&E of second region of classic PN morphology in another patient. k SOX10 protein expression in region of interest Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/37770931), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
SLC22A3 Antibody - BSA Free

Immunohistochemistry: SLC22A3 Antibody - BSA Free [NBP1-83976] -

IHC staining was used to validate single-nuclei RNA-seq data. a snRNA-seq harmony UMAP expression profile of endoneurial fibroblast marker LAMA2.b LAMA2 protein expression in 2 PN samples. c snRNA-seq harmony UMAP gene expression of perineurial fibroblast marker SLC22A. d SLC22A3 expression in 2 PN samples. e snRNA-seq UMAP expression of epineurial fibroblast marker PRRX1. f Representative H&E of classic PN morphology. f+ Zoomed in magnification of region of interest containing endoneurial, perineurial and epineurial zones. g PRRX1 protein expression in zoomed in region of interest. h SOX10 protein expression in same zoomed in region of interest. i snRNA-seq harmony UMAP expression profile of SOX10. j Representative H&E of second region of classic PN morphology in another patient. k SOX10 protein expression in region of interest Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/37770931), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for SLC22A3 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval method is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SLC22A3

SLC22A3 - solute carrier family 22 (extraneuronal monoamine transporter), member 3

Long Name

Solute carrier family 22 member 3

Alternate Names

EMTH, OCT3

Entrez Gene IDs

6581 (Human)

Gene Symbol

SLC22A3

UniProt

Additional SLC22A3 Products

Product Documents for SLC22A3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SLC22A3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for SLC22A3 Antibody - BSA Free

Customer Reviews for SLC22A3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SLC22A3 Antibody - BSA Free and earn rewards!

Have you used SLC22A3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...