SLC22A8 Antibody (3C11) - Azide and BSA Free

Novus Biologicals | Catalog # H00009376-M02

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Rat

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2b Kappa Clone # 3C11

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

SLC22A8 (NP_004245.2, 256 a.a. ~ 325 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TPESIRWLVLSGKSSKALKILRRVAVFNGKKEEGERLSLEELKLNLQKEISLAKAKYTASDLFRIPMLRR

Specificity

SLC22A8 - solute carrier family 22 (organic anion transporter), member 8 (3C11)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2b Kappa

Scientific Data Images for SLC22A8 Antibody (3C11) - Azide and BSA Free

Western Blot: SLC22A8 Antibody (3C11) [H00009376-M02]

Western Blot: SLC22A8 Antibody (3C11) [H00009376-M02]

Western Blot: SLC22A8 Antibody (3C11) [H00009376-M02] - SLC22A8 monoclonal antibody (M02), clone 3C11. Analysis of SLC22A8 expression in rat muscle.
ELISA: SLC22A8 Antibody (3C11) [H00009376-M02]

ELISA: SLC22A8 Antibody (3C11) [H00009376-M02]

ELISA: SLC22A8 Antibody (3C11) [H00009376-M02] - Detection limit for recombinant GST tagged SLC22A8 is 0.3 ng/ml as a capture antibody.

Applications for SLC22A8 Antibody (3C11) - Azide and BSA Free

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
This product is useful for ELISA.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: SLC22A8

The protein encoded by this gene is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and appears to be localized to the basolateral membrane of the kidney. [provided by RefSeq]

Alternate Names

hOAT3, MGC24086, OAT3Organic anion transporter 3, solute carrier family 22 (organic anion transporter), member 8, solute carrier family 22 member 8

Entrez Gene IDs

9376 (Human)

Gene Symbol

SLC22A8

Additional SLC22A8 Products

Product Documents for SLC22A8 Antibody (3C11) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SLC22A8 Antibody (3C11) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SLC22A8 Antibody (3C11) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review SLC22A8 Antibody (3C11) - Azide and BSA Free and earn rewards!

Have you used SLC22A8 Antibody (3C11) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...