SLC24A2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-25140

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SLC24A2 Primary Antibodies »

Product Specifications

Immunogen

This antibody has been engineered to specifically recognize the recombinant protein SLC24A2 using the following amino acid sequence: TEEGRFREKASILHKIAKKKCHVDENERQNGAANHVEKIELPNSTSTDVEMTPSSDASEPVQNGNLSHNIEGAEAQTADEEEDQPLSLAWPSETRKQ

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SLC24A2 Antibody - BSA Free

SLC24A2 Antibody Immunocytochemistry/Immunofluorescence: SLC24A2 Antibody [NBP3-25140]

Immunocytochemistry/Immunofluorescence: SLC24A2 Antibody [NBP3-25140]

Staining of human cell line K-562 shows localization to plasma membrane.

Applications for SLC24A2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 µg/ml
Application Notes
For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SLC24A2

Sodium/calcium-potassium exchanger proteins (NCKX1) have been reported to occur in retinal photoreceptors and in brain (NCKX2). Unlike the abundant and widely expressed sodium/calcium exchanger which catalyzes the exchange of 3 sodium ions for 1 calcium ion to modulate intracellular calcium levels, NCKX isoforms exchange 4 sodium ions for 1 calcium and 1 potassium ion. The sodium/calcium-potassium exchanger uses the transmembrane sodium gradient to catalyze countertransport of calcium in a potassium-dependent mechanism against its electrochemical gradient. It is hypothesized that NCKX2 plays a significant role in calcium homeostasis and the regulation of neuronal function.

Alternate Names

retinal cone Na-Ca+K exchanger, solute carrier family 24 (sodium/potassium/calcium exchanger), member 2

Gene Symbol

SLC24A2

Additional SLC24A2 Products

Product Documents for SLC24A2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SLC24A2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SLC24A2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SLC24A2 Antibody - BSA Free and earn rewards!

Have you used SLC24A2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies