SLC25A20 Antibody (3J1L5)

Novus Biologicals | Catalog # NBP3-33453

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse, Rat

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Rabbit IgG Clone # 3J1L5
View all SLC25A20 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SLC25A20 (NP_000378.1).

Sequence:
MADQPKPISPLKNLLAGGFGGVCLVFVGHPLDTVKVRLQTQPPSLPGQPPMYSGTFDCFRKTLFREGITGLYRGMAAPIIGVTPMFAVCFFGFGLGKKLQ

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for SLC25A20 Antibody (3J1L5)

SLC25A20 Antibody (3J1L5)

Western Blot: SLC25A20 Antibody (3J1L5) [NBP3-33453] -

Western Blot: SLC25A20 Antibody (3J1L5) [NBP3-33453] - Western blot analysis of lysates from Rat lung, using SLC25A20 Rabbit mAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 180s.
SLC25A20 Antibody (3J1L5)

Western Blot: SLC25A20 Antibody (3J1L5) [NBP3-33453] -

Western Blot: SLC25A20 Antibody (3J1L5) [NBP3-33453] - Western blot analysis of lysates from Mouse lung, using SLC25A20 Rabbit mAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 3s.

Applications for SLC25A20 Antibody (3J1L5)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: SLC25A20

The SLC25A20 gene product is one of several closely related mitochondrial-membrane carrier proteins that shuttle substrates between cytosol and the intramitochondrial matrix space. This protein mediates the transport of acylcarnitines into mitochondrial matrix fo

Alternate Names

CACCarnitine/acylcarnitine translocase, CACTSolute carrier family 25 member 20, mitochondrial carnitine/acylcarnitine carrier protein, solute carrier family 25 (carnitine/acylcarnitine translocase), member 20

Gene Symbol

SLC25A20

Additional SLC25A20 Products

Product Documents for SLC25A20 Antibody (3J1L5)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SLC25A20 Antibody (3J1L5)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SLC25A20 Antibody (3J1L5)

There are currently no reviews for this product. Be the first to review SLC25A20 Antibody (3J1L5) and earn rewards!

Have you used SLC25A20 Antibody (3J1L5)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies