SLC25A22 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-94069

Novus Biologicals
Loading...

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Human, Mouse, Rat

Applications

Knockout Validated, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 128-188 of human SLC25A22 (NP_078974.1). KIQLQDAGRIAAQRKILAAQGQLSAQGGAQPSVEAPAAPRPTATQLTRDLLRSRGIAGLYK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SLC25A22 Antibody - BSA Free

Western Blot: SLC25A22 AntibodyAzide and BSA Free [NBP2-94069]

Western Blot: SLC25A22 AntibodyAzide and BSA Free [NBP2-94069]

Western Blot: SLC25A22 Antibody [NBP2-94069] - Analysis of extracts of various cell lines, using SLC25A22 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.
Immunocytochemistry/ Immunofluorescence: SLC25A22 Antibody - Azide and BSA Free [NBP2-94069]

Immunocytochemistry/ Immunofluorescence: SLC25A22 Antibody - Azide and BSA Free [NBP2-94069]

Immunocytochemistry/Immunofluorescence: SLC25A22 Antibody [NBP2-94069] - Analysis of L929 cells using SLC25A22 at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunocytochemistry/ Immunofluorescence: SLC25A22 Antibody - Azide and BSA Free [NBP2-94069]

Immunocytochemistry/ Immunofluorescence: SLC25A22 Antibody - Azide and BSA Free [NBP2-94069]

Immunocytochemistry/Immunofluorescence: SLC25A22 Antibody [NBP2-94069] - Analysis of C6 cells using SLC25A22 at dilution of 1:100. Blue: DAPI for nuclear staining.
Knockout Validated: SLC25A22 Antibody - Azide and BSA Free [NBP2-94069]

Western Blot: SLC25A22 Antibody - Azide and BSA Free [NBP2-94069]

Western Blot: SLC25A22 Antibody [NBP2-94069] - Analysis of extracts from normal (control) and SLC25A22 knockout (KO) 293T cells, using SLC25A22 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk

Applications for SLC25A22 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50-1:200

Western Blot

1:500-1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: SLC25A22

The SLC25 gene family encodes mitochondrial carriers that transport a variety of metabolites across the inner mitochondrial membrane (Palmieri, 2004 [PubMed 14598172]). SLC25A22, also known as GC1, is 1 of the 2 mitochondrial glutamate/H+ symporters, the other being SLC25A18 (MIM 609303).[supplied by OMIM]

Alternate Names

EIEE3mitochondrial glutamate carrier 1, FLJ13044, GC1GC-1, Glutamate/H(+) symporter 1, NET44, solute carrier family 25 (mitochondrial carrier: glutamate), member 22, Solute carrier family 25 member 22

Gene Symbol

SLC25A22

Additional SLC25A22 Products

Product Documents for SLC25A22 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SLC25A22 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for SLC25A22 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SLC25A22 Antibody - BSA Free and earn rewards!

Have you used SLC25A22 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...