SLC39A14 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-17091

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SLC39A14 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: STCFSSGDLFTAHNFSEQSRIGSSELQEFCPTILQQLDSRACTSENQENEENEQTEEGRPSAVEVW

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SLC39A14 Antibody - BSA Free

Immunohistochemistry-Paraffin: SLC39A14 Antibody [NBP3-17091]

Immunohistochemistry-Paraffin: SLC39A14 Antibody [NBP3-17091]

Immunohistochemistry-Paraffin: SLC39A14 Antibody [NBP3-17091] - Analysis in human liver and tonsil tissues using Anti-SLC39A14 antibody. Corresponding SLC39A14 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: SLC39A14 Antibody [NBP3-17091]

Immunohistochemistry-Paraffin: SLC39A14 Antibody [NBP3-17091]

Immunohistochemistry-Paraffin: SLC39A14 Antibody [NBP3-17091] - Staining of human liver shows high expression.
Immunohistochemistry-Paraffin: SLC39A14 Antibody [NBP3-17091]

Immunohistochemistry-Paraffin: SLC39A14 Antibody [NBP3-17091]

Immunohistochemistry-Paraffin: SLC39A14 Antibody [NBP3-17091] - Staining of human tonsil shows low expression as expected.

Applications for SLC39A14 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SLC39A14

Zinc is an essential cofactor for hundreds of enzymes. It is involved in protein, nucleic acid, carbohydrate, and lipid metabolism, as well as in the control of gene transcription, growth, development, and differentiation. SLC39A14 belongs to a subfamily of proteins that show structural characteristics of zinc transporters (Taylor and Nicholson, 2003 (PubMed 12659941)).(supplied by OMIM)

Alternate Names

Irt-like protein 14, LIV-1 subfamily of ZIP zinc transporter 4, LZT-Hs4, solute carrier family 39 (metal ion transporter), member 14, solute carrier family 39 (zinc transporter), member 14, solute carrier family 39 member 14, zinc transporter ZIP14, ZIP14, ZIP-14, zrt- and Irt-like protein 14

Gene Symbol

SLC39A14

Additional SLC39A14 Products

Product Documents for SLC39A14 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SLC39A14 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SLC39A14 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SLC39A14 Antibody - BSA Free and earn rewards!

Have you used SLC39A14 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies