SLC6A15 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-83867

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SLC6A15 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: RELDDDVTESVKDLLSNEDAADDAFKTSELIVDGQEEKDTDVEEGSEVEDERPAWNSKLQ

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (80%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SLC6A15 Antibody - BSA Free

Western Blot: SLC6A15 Antibody [NBP1-83867]

Western Blot: SLC6A15 Antibody [NBP1-83867]

Western Blot: SLC6A15 Antibody [NBP1-83867] - Analysis in control (vector only transfected HEK293T lysate) and SLC6A15 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/ Immunofluorescence: SLC6A15 Antibody [NBP1-83867]

Immunocytochemistry/ Immunofluorescence: SLC6A15 Antibody [NBP1-83867]

Immunocytochemistry/Immunofluorescence: SLC6A15 Antibody [NBP1-83867] - Immunofluorescent staining of human cell line HEK 293 shows localization to nucleoli & vesicles.
Immunohistochemistry-Paraffin: SLC6A15 Antibody [NBP1-83867]

Immunohistochemistry-Paraffin: SLC6A15 Antibody [NBP1-83867]

Immunohistochemistry-Paraffin: SLC6A15 Antibody [NBP1-83867] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuronal cells.

Applications for SLC6A15 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SLC6A15

SLC6A15 shows structural characteristics of an Na(+) and Cl(-)-dependent neurotransmitter transporter, including 12 transmembrane (TM) domains, intracellular N and C termini, and large extracellular loops containing multiple N-glycosylation sites (Farmer et al., 2000 [PubMed 11112352]).[supplied by OMIM]

Alternate Names

B0AT2, DKFZp761I0921, FLJ10316, homolog of rat orphan transporter v7-3, hv7-3, MGC87066, NTT73orphan sodium- and chloride-dependent neurotransmitter transporter NTT73, orphan transporter v7-3, SBAT1, Sodium- and chloride-dependent neurotransmitter transporter NTT73, sodium/chloride dependent neurotransmitter transporter Homo sapiens orphanneurotransmitter transporter NTT7, Sodium-coupled branched-chain amino-acid transporter 1, solute carrier family 6 (neurotransmitter transporter), member 15, solute carrier family 6 (neutral amino acid transporter), member 15, Solute carrier family 6 member 15, solute carrier family 6, member 15, Transporter v7-3, V7-3

Gene Symbol

SLC6A15

Additional SLC6A15 Products

Product Documents for SLC6A15 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SLC6A15 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SLC6A15 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SLC6A15 Antibody - BSA Free and earn rewards!

Have you used SLC6A15 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies