SLFN12L Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-91060
![Immunohistochemistry-Paraffin: SLFN12L Antibody [NBP1-91060]](https://resources.rndsystems.com/images/products/SLFN12L-Antibody-Immunohistochemistry-Paraffin-NBP1-91060-img0005.jpg "Immunohistochemistry-Paraffin: SLFN12L Antibody [NBP1-91060]")
Loading...
Key Product Details
Species Reactivity
Validated:
Human
Cited:
Human, Mouse
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Flow Cytometry
Cited:
Flow Cytometry, IF/IHC
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: NRVKQLTEKEWIQFMVDSEPVCEELPSPASTSSPVSQSYPLREYINFKIQPLRYHLPGLSEKITCAPKTFCRNLFSQHEGLK
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for SLFN12L Antibody - BSA Free
Immunohistochemistry-Paraffin: SLFN12L Antibody [NBP1-91060]
Immunohistochemistry-Paraffin: SLFN12L Antibody [NBP1-91060] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.![Immunohistochemistry-Paraffin: SLFN12L Antibody [NBP1-91060]](https://resources.rndsystems.com/images/products/SLFN12L-Antibody-Immunohistochemistry-Paraffin-NBP1-91060-img0002.jpg "Immunohistochemistry-Paraffin: SLFN12L Antibody [NBP1-91060]")
Immunohistochemistry-Paraffin: SLFN12L Antibody [NBP1-91060]
Immunohistochemistry-Paraffin: SLFN12L Antibody [NBP1-91060] - Staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.![Immunohistochemistry-Paraffin: SLFN12L Antibody [NBP1-91060]](https://resources.rndsystems.com/images/products/SLFN12L-Antibody-Immunohistochemistry-Paraffin-NBP1-91060-img0003.jpg "Immunohistochemistry-Paraffin: SLFN12L Antibody [NBP1-91060]")
Immunohistochemistry-Paraffin: SLFN12L Antibody [NBP1-91060]
Immunohistochemistry-Paraffin: SLFN12L Antibody [NBP1-91060] - Staining of human gastrointestinal shows moderate cytoplasmic positivity in glandular cells.![Immunohistochemistry-Paraffin: SLFN12L Antibody [NBP1-91060]](https://resources.rndsystems.com/images/products/SLFN12L-Antibody-Immunohistochemistry-Paraffin-NBP1-91060-img0004.jpg "Immunohistochemistry-Paraffin: SLFN12L Antibody [NBP1-91060]")
Immunohistochemistry-Paraffin: SLFN12L Antibody [NBP1-91060]
Immunohistochemistry-Paraffin: SLFN12L Antibody [NBP1-91060] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.Applications for SLFN12L Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:20 - 1:50
Immunohistochemistry-Paraffin
1:20 - 1:50
Application Notes
Use in Flow reported in scientific literature (PMID:35487288) For IHC-Paraffin, HIER pH 6 retrieval is recommended..
Flow Cytometry Panel Builder
Bio-Techne Knows Flow Cytometry
Save time and reduce costly mistakes by quickly finding compatible reagents using the Panel Builder Tool.
Advanced Features
- Spectra Viewer - Custom analysis of spectra from multiple fluorochromes
- Spillover Popups - Visualize the spectra of individual fluorochromes
- Antigen Density Selector - Match fluorochrome brightness with antigen density
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: SLFN12L
Alternate Names
FLJ23922, schlafen family member 12-like
Gene Symbol
SLFN12L
Additional SLFN12L Products
Product Documents for SLFN12L Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for SLFN12L Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for SLFN12L Antibody - BSA Free
Powered by Bioz
Customer Reviews for SLFN12L Antibody - BSA Free
There are currently no reviews for this product. Be the first to review SLFN12L Antibody - BSA Free and earn rewards!
Have you used SLFN12L Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- 7-Amino Actinomycin D (7-AAD) Cell Viability Flow Cytometry Protocol
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Extracellular Membrane Flow Cytometry Protocol
- Flow Cytometry Protocol for Cell Surface Markers
- Flow Cytometry Protocol for Staining Membrane Associated Proteins
- Flow Cytometry Staining Protocols
- Flow Cytometry Troubleshooting Guide
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Intracellular Flow Cytometry Protocol Using Alcohol (Methanol)
- Intracellular Flow Cytometry Protocol Using Detergents
- Intracellular Nuclear Staining Flow Cytometry Protocol Using Detergents
- Intracellular Staining Flow Cytometry Protocol Using Alcohol Permeabilization
- Intracellular Staining Flow Cytometry Protocol Using Detergents to Permeabilize Cells
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Propidium Iodide Cell Viability Flow Cytometry Protocol
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Liperfluo
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Characterization of Human Th22 Cells
- Protocol for the Characterization of Human Th9 Cells
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol: Annexin V and PI Staining by Flow Cytometry
- Protocol: Annexin V and PI Staining for Apoptosis by Flow Cytometry
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Fluorokine Flow Cytometry Kits
- Troubleshooting Guide: Immunohistochemistry
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...