SMAP1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35784

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 180-250 of human SMAP1 (NP_001037770).

Sequence:
EPEKPAKPLTAEKLQKKDQQLEPKKSTSPKKAAEPTVDLLGLDGPAVAPVTNGNTTVPPLNDDLDIFGPMI

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

50 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for SMAP1 Antibody - BSA Free

SMAP1 Antibody

Immunocytochemistry/ Immunofluorescence: SMAP1 Antibody [NBP3-35784] -

Immunocytochemistry/ Immunofluorescence: SMAP1 Antibody [NBP3-35784] - Immunofluorescence analysis of HeLa cells using SMAP1 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
SMAP1 Antibody

Immunocytochemistry/ Immunofluorescence: SMAP1 Antibody [NBP3-35784] -

Immunocytochemistry/ Immunofluorescence: SMAP1 Antibody [NBP3-35784] - Immunofluorescence analysis of C6 cells using SMAP1 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
SMAP1 Antibody

Immunocytochemistry/ Immunofluorescence: SMAP1 Antibody [NBP3-35784] -

Immunocytochemistry/ Immunofluorescence: SMAP1 Antibody [NBP3-35784] - Immunofluorescence analysis of L929 cells using SMAP1 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
SMAP1 Antibody

Western Blot: SMAP1 Antibody [NBP3-35784] -

Western Blot: SMAP1 Antibody [NBP3-35784] - Western blot analysis of lysates from Mouse heart, using SMAP1 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 1s.

Applications for SMAP1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: SMAP1

SMAP1 is encoded by this gene is similar to the mouse stromal membrane-associated protein-1. This similarity suggests that this human gene product is also a type II membrane glycoprotein involved in the erythropoietic stimulatory activity of stromal cells. Alternate splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq]

Alternate Names

FLJ13159, FLJ42245, small ArfGAP 1, SMAP-1, stromal membrane-associated GTPase-activating protein 1, stromal membrane-associated protein 1

Gene Symbol

SMAP1

Additional SMAP1 Products

Product Documents for SMAP1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SMAP1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SMAP1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SMAP1 Antibody - BSA Free and earn rewards!

Have you used SMAP1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...