Recombinant Human SMC1 GST (N-Term) Protein

Novus Biologicals | Catalog # H00008243-Q01

Novus Biologicals
Loading...

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Applications

Western Blot, ELISA, Affinity Purification, Endotoxin Detection
Loading...

Product Specifications

Description

A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 366-465 of Human SMC1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: TLEENQVKKYHRLKEEASKRAATLAQELEKFNRDQKADQDRLDLEERKKVETEAKIKQKLREIEENQKRIEKLEEYITTSKQSLEEQKKLEGELTEEVEM

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human SMC1 GST (N-Term) Protein

12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation, and Storage

H00008243-Q01
Preparation Method in vitro wheat germ expression system
Formulation 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: SMC1

SMC1L1 - SMC1 structural maintenance of chromosomes 1-like 1 (yeast)

Long Name

Structural Maintenance of Chromosomes 1

Alternate Names

SB1.8, SMC1A, SMC1L1

Gene Symbol

SMC1A

Additional SMC1 Products

Product Documents for Recombinant Human SMC1 GST (N-Term) Protein

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Recombinant Human SMC1 GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for Recombinant Human SMC1 GST (N-Term) Protein

There are currently no reviews for this product. Be the first to review Recombinant Human SMC1 GST (N-Term) Protein and earn rewards!

Have you used Recombinant Human SMC1 GST (N-Term) Protein?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs for Recombinant Human SMC1 GST (N-Term) Protein

Showing  1 - 2 of 2 FAQs Showing All
  • Q: I would like to use one of your anti-smc1 antibodies to detect smc1 in an invertebrate. Your different antibodies are raised against different peptides derived from different regions possibly well-conserved, but not completely, in the organism that interests me (Schistosoma mansoni). Would it be possible to know the sequence of the different peptides that was used to generate the different antibodies, or failing that, could you analyze the corresponding sequence in my species of interest in order to determine whether or not it corresponds to one of the different peptides?

    A:

    My suggestion to you would be to look at the homology between the protein expressed in your species and the protein expressed in the reactive species of the antibodies. A homology of >90% is a great start, >80% is acceptable. Please view our list of smc1 antibodies we currently offer and there are 27 products.

  • Q: My sequence of interest have >80% homology with the N-term and the C-term parts of human smc1. Your antibodies NB100-78322 and NB100-204 recognized the N-term and C-term of human smc1 respectively, therefore it’s possible that the cross reactivity can happen. I would be very interested to test these antibodies (NB100-78322 and NB100-204). Can you provide me free sample (few ul) to do western blot. I will share the testing result with you.

    A:

    We do not provide free samples for testing. If you are interested in testing these antibodies in an unlisted species or application, you would qualify for the Innovator's Rewards program. The way the program works is that you would purchase the antibody of interest, perform your testing using appropriate controls and then share your data with us. Upon review of your data we would issue you a voucher for a free antibody. You can find more details here.

  • Q: I would like to use one of your anti-smc1 antibodies to detect smc1 in an invertebrate. Your different antibodies are raised against different peptides derived from different regions possibly well-conserved, but not completely, in the organism that interests me (Schistosoma mansoni). Would it be possible to know the sequence of the different peptides that was used to generate the different antibodies, or failing that, could you analyze the corresponding sequence in my species of interest in order to determine whether or not it corresponds to one of the different peptides?

    A:

    My suggestion to you would be to look at the homology between the protein expressed in your species and the protein expressed in the reactive species of the antibodies. A homology of >90% is a great start, >80% is acceptable. Please view our list of smc1 antibodies we currently offer and there are 27 products.

  • Q: My sequence of interest have >80% homology with the N-term and the C-term parts of human smc1. Your antibodies NB100-78322 and NB100-204 recognized the N-term and C-term of human smc1 respectively, therefore it’s possible that the cross reactivity can happen. I would be very interested to test these antibodies (NB100-78322 and NB100-204). Can you provide me free sample (few ul) to do western blot. I will share the testing result with you.

    A:

    We do not provide free samples for testing. If you are interested in testing these antibodies in an unlisted species or application, you would qualify for the Innovator's Rewards program. The way the program works is that you would purchase the antibody of interest, perform your testing using appropriate controls and then share your data with us. Upon review of your data we would issue you a voucher for a free antibody. You can find more details here.

Showing  1 - 2 of 2 FAQs Showing All
View all FAQs for Proteins and Enzymes
Loading...