Recombinant Human SMC1 GST (N-Term) Protein
Novus Biologicals | Catalog # H00008243-Q01
Key Product Details
Source
Tag
Applications
Product Specifications
Description
Source: Wheat Germ (in vitro)
Amino Acid Sequence: TLEENQVKKYHRLKEEASKRAATLAQELEKFNRDQKADQDRLDLEERKKVETEAKIKQKLREIEENQKRIEKLEEYITTSKQSLEEQKKLEGELTEEVEM
Purity
Predicted Molecular Mass
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Activity
Protein / Peptide Type
Scientific Data Images for Recombinant Human SMC1 GST (N-Term) Protein
Formulation, Preparation, and Storage
H00008243-Q01
| Preparation Method | in vitro wheat germ expression system |
| Formulation | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Preservative | No Preservative |
| Concentration | Please see the vial label for concentration. If unlisted please contact technical services. |
| Shipping | The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below. |
| Stability & Storage | Store at -80C. Avoid freeze-thaw cycles. |
Background: SMC1
Long Name
Alternate Names
Gene Symbol
Additional SMC1 Products
Product Documents for Recombinant Human SMC1 GST (N-Term) Protein
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Recombinant Human SMC1 GST (N-Term) Protein
This product is produced by and distributed for Abnova, a company based in Taiwan.
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.
Customer Reviews for Recombinant Human SMC1 GST (N-Term) Protein
There are currently no reviews for this product. Be the first to review Recombinant Human SMC1 GST (N-Term) Protein and earn rewards!
Have you used Recombinant Human SMC1 GST (N-Term) Protein?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
FAQs for Recombinant Human SMC1 GST (N-Term) Protein
-
Q: I would like to use one of your anti-smc1 antibodies to detect smc1 in an invertebrate. Your different antibodies are raised against different peptides derived from different regions possibly well-conserved, but not completely, in the organism that interests me (Schistosoma mansoni). Would it be possible to know the sequence of the different peptides that was used to generate the different antibodies, or failing that, could you analyze the corresponding sequence in my species of interest in order to determine whether or not it corresponds to one of the different peptides?
A:
My suggestion to you would be to look at the homology between the protein expressed in your species and the protein expressed in the reactive species of the antibodies. A homology of >90% is a great start, >80% is acceptable. Please view our list of smc1 antibodies we currently offer and there are 27 products.
-
Q: My sequence of interest have >80% homology with the N-term and the C-term parts of human smc1. Your antibodies NB100-78322 and NB100-204 recognized the N-term and C-term of human smc1 respectively, therefore it’s possible that the cross reactivity can happen. I would be very interested to test these antibodies (NB100-78322 and NB100-204). Can you provide me free sample (few ul) to do western blot. I will share the testing result with you.
A:
We do not provide free samples for testing. If you are interested in testing these antibodies in an unlisted species or application, you would qualify for the Innovator's Rewards program. The way the program works is that you would purchase the antibody of interest, perform your testing using appropriate controls and then share your data with us. Upon review of your data we would issue you a voucher for a free antibody. You can find more details here.
-
Q: I would like to use one of your anti-smc1 antibodies to detect smc1 in an invertebrate. Your different antibodies are raised against different peptides derived from different regions possibly well-conserved, but not completely, in the organism that interests me (Schistosoma mansoni). Would it be possible to know the sequence of the different peptides that was used to generate the different antibodies, or failing that, could you analyze the corresponding sequence in my species of interest in order to determine whether or not it corresponds to one of the different peptides?
A:
My suggestion to you would be to look at the homology between the protein expressed in your species and the protein expressed in the reactive species of the antibodies. A homology of >90% is a great start, >80% is acceptable. Please view our list of smc1 antibodies we currently offer and there are 27 products.
-
Q: My sequence of interest have >80% homology with the N-term and the C-term parts of human smc1. Your antibodies NB100-78322 and NB100-204 recognized the N-term and C-term of human smc1 respectively, therefore it’s possible that the cross reactivity can happen. I would be very interested to test these antibodies (NB100-78322 and NB100-204). Can you provide me free sample (few ul) to do western blot. I will share the testing result with you.
A:
We do not provide free samples for testing. If you are interested in testing these antibodies in an unlisted species or application, you would qualify for the Innovator's Rewards program. The way the program works is that you would purchase the antibody of interest, perform your testing using appropriate controls and then share your data with us. Upon review of your data we would issue you a voucher for a free antibody. You can find more details here.