SMC6L1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-33378

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SMC6L1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: KEEHGKIKREELDVKHALSYNQRQLKELKDSKTDRLKRFGPNVPALLEAIDDAYRQGHFTYKPVGPLGACIHLRDPELALAIESCL

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%), Rat (84%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SMC6L1 Antibody - BSA Free

Immunohistochemistry-Paraffin: SMC6L1 Antibody [NBP2-33378]

Immunohistochemistry-Paraffin: SMC6L1 Antibody [NBP2-33378]

Immunohistochemistry-Paraffin: SMC6L1 Antibody [NBP2-33378] - Staining of human testis shows weak nuclear positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: SMC6L1 Antibody [NBP2-33378]

Immunohistochemistry-Paraffin: SMC6L1 Antibody [NBP2-33378]

Immunohistochemistry-Paraffin: SMC6L1 Antibody [NBP2-33378] - Staining of human placenta shows weak nuclear positivity in a subset of trophoblastic cells.
Immunohistochemistry-Paraffin: SMC6L1 Antibody [NBP2-33378]

Immunohistochemistry-Paraffin: SMC6L1 Antibody [NBP2-33378]

Immunohistochemistry-Paraffin: SMC6L1 Antibody [NBP2-33378] - Staining of human prostate shows weak nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: SMC6L1 Antibody [NBP2-33378]

Immunohistochemistry-Paraffin: SMC6L1 Antibody [NBP2-33378]

Immunohistochemistry-Paraffin: SMC6L1 Antibody [NBP2-33378] - Staining of human skeletal muscle shows no nuclear positivity in striated muscle fibers as expected.

Applications for SMC6L1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SMC6L1

SMC (Structural maintenance of chromosomes) proteins are members of multisubunit complexes that play a critical role in chromosome organization, segregation, gene regulation, and DNA repair. Two of these complexes, cohesin and condensin consist of a core complex of an SMC1 and SMC3 heterodimer or an SMC2 and SMC4 heterodimer, respectively. A third complex includes a heterodimer of SMC5 and SMC6 whose function is not fully understood but is proposed to be related to DNA repair.

Alternate Names

FLJ22116, hSMC6, SMC protein 6, SMC-6, SMC6 structural maintenance of chromosomes 6-like 1, SMC6 structural maintenance of chromosomes 6-like 1 (yeast), SMC6L1FLJ35534, structural maintenance of chromosomes 6, structural maintenance of chromosomes protein 6

Gene Symbol

SMC6

UniProt

Q96SB8 (Human)

Additional SMC6L1 Products

Product Documents for SMC6L1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SMC6L1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SMC6L1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SMC6L1 Antibody - BSA Free and earn rewards!

Have you used SMC6L1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies