SorCS1 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-86096
Loading...
Key Product Details
Validated by
Knockout/Knockdown
Species Reactivity
Human
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence, Knockdown Validated
Cited:
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EWRRDIGRVIKKSLVEATGVPGQHILVAVLPGLPTTAELFVLPYQDPAGENKRSTDDLEQISELLIHTLNQNSVHFELKPGVRVLVHAAHLTAAPLVDLT
Reactivity Notes
Mouse (87%), Rat (88%).
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for SorCS1 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence: SorCS1 Antibody [NBP1-86096]
Immunocytochemistry/Immunofluorescence: SorCS1 Antibody [NBP1-86096] - Staining of human cell line U-251 MG shows localization to plasma membrane & cytosol. Antibody staining is shown in green.Immunohistochemistry-Paraffin: SorCS1 Antibody [NBP1-86096]
Immunohistochemistry-Paraffin: SorCS1 Antibody [NBP1-86096] - Staining of human liver shows no positivity in hepatocytes as expected.Immunohistochemistry-Paraffin: SorCS1 Antibody [NBP1-86096]
Immunohistochemistry-Paraffin: SorCS1 Antibody [NBP1-86096] - Staining of human cerebral cortex shows moderate positivity in neuronal processes.Immunohistochemistry-Paraffin: SorCS1 Antibody [NBP1-86096]
Immunohistochemistry-Paraffin: SorCS1 Antibody [NBP1-86096] - Staining of human small intestine shows strong positivity in apical membrane in glandular cells.Immunohistochemistry-Paraffin: SorCS1 Antibody [NBP1-86096]
Immunohistochemistry-Paraffin: SorCS1 Antibody [NBP1-86096] - Staining of human lymph node shows moderate membranous positivity in germinal center cells.Applications for SorCS1 Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:1000 - 1:2500
Immunohistochemistry-Paraffin
1:1000 - 1:2500
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Reviewed Applications
Read 4 reviews rated 4.3 using NBP1-86096 in the following applications:
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: SorCS1
Long Name
Sortilin-related VPS10 Domain Containing Receptor 1
Alternate Names
FLJ41758, FLJ43475, FLJ44957, hSorCS, SORCS, SORCS receptor 1, sorCS1, sortilin-related VPS10 domain containing receptor 1, VPS10 domain receptor protein SORCS 1, VPS10 domain receptor SorCS, VPS10 domain-containing receptor SorCS1
Gene Symbol
SORCS1
Additional SorCS1 Products
Product Documents for SorCS1 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for SorCS1 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Citations for SorCS1 Antibody - BSA Free
Customer Reviews for SorCS1 Antibody - BSA Free (4)
4.3 out of 5
4 Customer Ratings
Have you used SorCS1 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Showing
1
-
4 of
4 reviews
Showing All
Filter By:
-
Application: Western BlotSample Tested: CHO cells stable expressing mouse SorCS1Species: MouseVerified Customer | Posted 12/17/2014
-
Application: Western BlotSample Tested: CHO-cells stable expressing human SorCS1Species: HumanVerified Customer | Posted 12/17/2014
-
Application: ImmunoprecipitationSample Tested: human sorCS1Species: HumanVerified Customer | Posted 12/17/2014
-
Application: Western BlotSample Tested: human sorCS1Species: HumanVerified Customer | Posted 12/17/2014
There are no reviews that match your criteria.
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...