Sortilin Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-89745

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Cited:

Human

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Cited:

Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Sortilin Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: LERNCEEKDYTIWLAHSTDPEDYEDGCILGYKEQFLRLRKSSVCQNGRDYVVTKQPSICLCSLEDFLCDFGYYRPENDSKCVEQPELKGHDLEFCLYGREEHLTTNGYRKIPGDKCQGGVNPVREVKD

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%), Rat (89%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Sortilin Antibody - BSA Free

Sortilin Antibody - BSA Free Immunohistochemistry-Paraffin: Sortilin Antibody - BSA Free [NBP1-89745]

Immunohistochemistry-Paraffin: Sortilin Antibody - BSA Free [NBP1-89745]

Analysis in human cerebral cortex and lymph node tissues using NBP1-89745 antibody. Corresponding SORT1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Sortilin Antibody [NBP1-89745]

Immunohistochemistry-Paraffin: Sortilin Antibody [NBP1-89745]

Immunohistochemistry-Paraffin: Sortilin Antibody [NBP1-89745] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: Sortilin Antibody [NBP1-89745]

Immunohistochemistry-Paraffin: Sortilin Antibody [NBP1-89745]

Immunohistochemistry-Paraffin: Sortilin Antibody [NBP1-89745] - Staining of human hippocampus shows strong cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: Sortilin Antibody [NBP1-89745]

Immunohistochemistry-Paraffin: Sortilin Antibody [NBP1-89745]

Immunohistochemistry-Paraffin: Sortilin Antibody [NBP1-89745] - Staining of human lymph node shows no positivity in non-germinal center cells as expected.
Immunohistochemistry-Paraffin: Sortilin Antibody [NBP1-89745]

Immunohistochemistry-Paraffin: Sortilin Antibody [NBP1-89745]

Immunohistochemistry-Paraffin: Sortilin Antibody [NBP1-89745] - Staining of human skin shows no positivity in squamous epithelial cells as expected.
Sortilin Antibody - BSA Free Western Blot: Sortilin Antibody - BSA Free [NBP1-89745]

Western Blot: Sortilin Antibody - BSA Free [NBP1-89745]

Analysis in human cell lines SK-MEL-30 and PC-3 using Anti-SORT1 antibody. Corresponding SORT1 RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.

Applications for Sortilin Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20-1:50

Western Blot

0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Sortilin

Functions as a sorting receptor in the Golgi compartment and as a clearance receptor on the cell surface. Required for protein transport from the Golgi apparatus to the lysosomes by a pathway that is independent of the mannose-6-phosphate receptor (M6PR). Also required for protein transport from the Golgi apparatus to the endosomes. Promotes neuronal apoptosis by mediating endocytosis of the proapoptotic precursor forms of BDNF (proBDNF) and NGFB (proNGFB). Also acts as a receptor for neurotensin. May promote mineralization of the extracellular matrix during osteogenic differentiation by scavenging extracellular LPL. Probably required in adipocytes for the formation of specialized storage vesicles containing the glucose transporter SLC2A4/GLUT4 (GLUT4 storage vesicles, or GSVs). These vesicles provide a stable pool of SLC2A4 and confer increased responsiveness to insulin. May also mediate transport from the endoplasmic reticulum to the Golgi.

Alternate Names

Gp95, Ntr3, SORT1

Gene Symbol

SORT1

Additional Sortilin Products

Product Documents for Sortilin Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Sortilin Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Sortilin Antibody - BSA Free

Customer Reviews for Sortilin Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Sortilin Antibody - BSA Free and earn rewards!

Have you used Sortilin Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Sortilin Antibody - BSA Free

Showing  1 - 2 of 2 FAQs Showing All

  • Q: NBP1-89745 - what does "HIER" for the retrieval method of IHC-paraffin mean?

    A: hier= heat induced epitope retrieval. Concept: Antigen Retrieval Protocol (HIER). Fixing proteins with formalin creates crosslinks. In the process of crosslinking, antigen in the tissue can be masked, restricting antibody-target binding. The impaired ability of the antibody to access its epitope can result in weak signal or false negative staining. To promote epitope availability and enhance immunogenicity, one of several antigen retrieval methods is used. Proteolytic-Induced Epitope Retrieval (PIER) is an enzymatic method of antigen retrieval which relies on enzymes such as proteinase K, trypsin, or pepsin to unmask antigen. Heat-Induced Epitope Retrieval (HIER) utilizes heat to promote epitope availability. Optimal retrieval conditions depend on the type of tissue, fixation, and antibody, necessitating optimization for each antigen.

  • Q: NBP1-89745 - what does "HIER" for the retrieval method of IHC-paraffin mean?

    A: HIER= heat induced epitope retrieval. Concept: Antigen Retrieval Protocol (HIER). Fixing proteins with formalin creates crosslinks. In the process of crosslinking, antigen in the tissue can be masked, restricting antibody-target binding. The impaired ability of the antibody to access its epitope can result in weak signal or false negative staining. To promote epitope availability and enhance immunogenicity, one of several antigen retrieval methods is used. Proteolytic-Induced Epitope Retrieval (PIER) is an enzymatic method of antigen retrieval which relies on enzymes such as proteinase K, trypsin, or pepsin to unmask antigen. Heat-Induced Epitope Retrieval (HIER) utilizes heat to promote epitope availability. Optimal retrieval conditions depend on the type of tissue, fixation, and antibody, necessitating optimization for each antigen.

  • Q: NBP1-89745 - what does "HIER" for the retrieval method of IHC-paraffin mean?

    A: hier= heat induced epitope retrieval. Concept: Antigen Retrieval Protocol (HIER). Fixing proteins with formalin creates crosslinks. In the process of crosslinking, antigen in the tissue can be masked, restricting antibody-target binding. The impaired ability of the antibody to access its epitope can result in weak signal or false negative staining. To promote epitope availability and enhance immunogenicity, one of several antigen retrieval methods is used. Proteolytic-Induced Epitope Retrieval (PIER) is an enzymatic method of antigen retrieval which relies on enzymes such as proteinase K, trypsin, or pepsin to unmask antigen. Heat-Induced Epitope Retrieval (HIER) utilizes heat to promote epitope availability. Optimal retrieval conditions depend on the type of tissue, fixation, and antibody, necessitating optimization for each antigen.

  • Q: NBP1-89745 - what does "HIER" for the retrieval method of IHC-paraffin mean?

    A: HIER= heat induced epitope retrieval. Concept: Antigen Retrieval Protocol (HIER). Fixing proteins with formalin creates crosslinks. In the process of crosslinking, antigen in the tissue can be masked, restricting antibody-target binding. The impaired ability of the antibody to access its epitope can result in weak signal or false negative staining. To promote epitope availability and enhance immunogenicity, one of several antigen retrieval methods is used. Proteolytic-Induced Epitope Retrieval (PIER) is an enzymatic method of antigen retrieval which relies on enzymes such as proteinase K, trypsin, or pepsin to unmask antigen. Heat-Induced Epitope Retrieval (HIER) utilizes heat to promote epitope availability. Optimal retrieval conditions depend on the type of tissue, fixation, and antibody, necessitating optimization for each antigen.

Showing  1 - 2 of 2 FAQs Showing All
View all FAQs for Antibodies