SOX22 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-56628

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (91%), Rat (91%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SOX22 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DEELLEVRLVETPGRELWRMVPAGRAARGQAE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SOX22 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: SOX22 Antibody [NBP2-56628]

Immunocytochemistry/ Immunofluorescence: SOX22 Antibody [NBP2-56628]

Immunocytochemistry/Immunofluorescence: SOX22 Antibody [NBP2-56628] - Staining of human cell line PC-3 shows localization to nucleoplasm.

Applications for SOX22 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SOX22

Members of the SOX family of transcription factors are characterized by the presence of a DNA-binding high mobility group (HMG) domain, homologous to the HMG box of sex-determining region Y (SRY). Forming a subgroup of the HMG domain superfamily, SOX proteins have been implicated in cell fate decisions in a diverse range of developmental processes. SOX transcription factors have diverse tissue-specific expression patterns during early development and have been proposed to act as target-specific transcription factors and/or as chromatin structure regulatory elements. The protein encoded by this gene was identified as a SOX family member based on conserved domains and its expression in various tissues suggests a role in both differentiation and maintenance of several cell types.

Long Name

SRY-box transcription factor 12

Alternate Names

Protein SOX-22, SOX22, SOX-22 protein, SOX22transcription factor SOX-12, SRY (sex determining region Y)-box 12, SRY (sex determining region Y)-box 22, SRY-related HMG-box gene 22

Gene Symbol

SOX12

Additional SOX22 Products

Product Documents for SOX22 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SOX22 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SOX22 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SOX22 Antibody - BSA Free and earn rewards!

Have you used SOX22 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies