SOX5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-74096

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SOX5 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to the C terminal of SOX5 (NP_821078). Immunizing peptide sequence PEPGMPVIQSTYGVKGEEPHIKEEIQAEDINGEIYDEYDEEEDDPDVDYG. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

42 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for SOX5 Antibody - BSA Free

Western Blot: SOX5 Antibody [NBP1-74096]

Western Blot: SOX5 Antibody [NBP1-74096]

Western Blot: SOX5 Antibody [NBP1-74096] - Sample Tissue: HepG2 cell lysates, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 2.0ug/ml, Peptide Concentration: 0.0ug/ml, Lysate Quantity: 25ug/lane
Western Blot: SOX5 Antibody [NBP1-74096]

Western Blot: SOX5 Antibody [NBP1-74096]

Western Blot: SOX5 Antibody [NBP1-74096] - Dilution: 1 ug/ml on Hela cell lysate.
Western Blot: SOX5 Antibody [NBP1-74096]

Western Blot: SOX5 Antibody [NBP1-74096]

Western Blot: SOX5 Antibody [NBP1-74096] - Sample Tissue: HepG2, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 2.0ug/mL, Peptide Concentration: 2.0ug/mL, Lysate Quantity: 25ug/lane, Gel Concentration: 12%

Applications for SOX5 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SOX5

SOX5 encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. The encoded protein may play a role in chondrogenesis. A pseudogene of this gene is located on chromosome 8.

Long Name

SRY-related HMG-box 5

Alternate Names

L-SOX5

Entrez Gene IDs

6660 (Human)

Gene Symbol

SOX5

UniProt

P35711

Additional SOX5 Products

Product Documents for SOX5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SOX5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SOX5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SOX5 Antibody - BSA Free and earn rewards!

Have you used SOX5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies