SP-D Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-33424

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SP-D Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: LQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTD

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SP-D Antibody - BSA Free

Western Blot: SP-D Antibody [NBP2-33424]

Western Blot: SP-D Antibody [NBP2-33424]

Western Blot: SP-D Antibody [NBP2-33424] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Liver
Immunohistochemistry-Paraffin: SP-D Antibody [NBP2-33424]

Immunohistochemistry-Paraffin: SP-D Antibody [NBP2-33424]

Immunohistochemistry-Paraffin: SP-D Antibody [NBP2-33424] - Staining of human cerebral cortex.
Immunohistochemistry-Paraffin: SP-D Antibody [NBP2-33424]

Immunohistochemistry-Paraffin: SP-D Antibody [NBP2-33424]

Immunohistochemistry-Paraffin: SP-D Antibody [NBP2-33424] - Staining of human kidney shows low expression as expected.
Immunohistochemistry-Paraffin: SP-D Antibody [NBP2-33424]

Immunohistochemistry-Paraffin: SP-D Antibody [NBP2-33424]

Immunohistochemistry-Paraffin: SP-D Antibody [NBP2-33424] - Staining of human lung shows high expression.
Immunohistochemistry-Paraffin: SP-D Antibody [NBP2-33424]

Immunohistochemistry-Paraffin: SP-D Antibody [NBP2-33424]

Immunohistochemistry-Paraffin: SP-D Antibody [NBP2-33424] - Staining in human lung and kidney tissues using anti-SFTPD antibody. Corresponding SFTPD RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: SP-D Antibody [NBP2-33424]

Immunohistochemistry-Paraffin: SP-D Antibody [NBP2-33424]

Immunohistochemistry-Paraffin: SP-D Antibody [NBP2-33424] - Staining of human cerebral cortex, colon, lung and lymph node using Anti-SFTPD antibody NBP2-33424 (A) shows similar protein distribution across tissues to independent antibody NBP2-38803 (B).
Immunohistochemistry-Paraffin: SP-D Antibody [NBP2-33424]

Immunohistochemistry-Paraffin: SP-D Antibody [NBP2-33424]

Immunohistochemistry-Paraffin: SP-D Antibody [NBP2-33424] - Staining of human lymph node.
Immunohistochemistry-Paraffin: SP-D Antibody [NBP2-33424]

Immunohistochemistry-Paraffin: SP-D Antibody [NBP2-33424]

Immunohistochemistry-Paraffin: SP-D Antibody [NBP2-33424] - Staining of human colon.

Applications for SP-D Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:2500 - 1:5000

Immunohistochemistry-Paraffin

1:2500 - 1:5000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SP-D

Surfactant protein D (SP-D) is synthesized and secreted by lung epithelial cells. It belongs to group III of the family of C-type lectins and members of this group has overall structure consisting of multiple globular head regions linked by triple-helical, collagen-like, strands. This group also includes SP-A and the serum proteins mannan-binding protein, conglutinin and collectin-43, all of which have been shown to bind to the C1q receptor found on a wide variety of cells. Both SP-D and SP-A have been shown to enhance oxygen radical production by alveolar macrophages. The serum concentration is 88 ng/ml in healthy individuals (2).

Long Name

Surfactant Pulmonary Associated Protein D

Alternate Names

Collectin 7, PSP-D, SFTP4, SFTPD, SPD

Gene Symbol

SFTPD

UniProt

P35247

Additional SP-D Products

Product Documents for SP-D Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SP-D Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SP-D Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SP-D Antibody - BSA Free and earn rewards!

Have you used SP-D Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies