SP110 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-56189

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SP110 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PLPALIQEGRSTSVTNDKLTSKMNAEEDSEEMPSLLTSTVQVASDNLIPQIRDKEDPQEMPHSPLGSMPEIRDNSPEPNDPE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SP110 Antibody - BSA Free

Western Blot: SP110 Antibody [NBP2-56189]

Western Blot: SP110 Antibody [NBP2-56189]

Western Blot: SP110 Antibody [NBP2-56189] - Western blot analysis in human cell line RT-4.
Immunocytochemistry/ Immunofluorescence: SP110 Antibody [NBP2-56189]

Immunocytochemistry/ Immunofluorescence: SP110 Antibody [NBP2-56189]

Immunocytochemistry/Immunofluorescence: SP110 Antibody [NBP2-56189] - Staining of human cell line U-2 OS shows localization to nucleus.

Applications for SP110 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SP110

The nuclear body is a multiprotein complex that may have a role in the regulation of gene transcription. This gene is a member of the SP100/SP140 family of nuclear body proteins and encodes a leukocyte-specific nuclear body component. The protein can function as an activator of gene transcription and may serve as a nuclear hormone receptor coactivator. In addition, it has been suggested that the protein may play a role in ribosome biogenesis and in the induction of myeloid cell differentiation. Alternative splicing has been observed for this gene and three transcript variants, encoding distinct isoforms, have been identified.

Alternate Names

FLJ22835, IFI41, IFI75, interferon-induced protein 41, 30kD, Interferon-induced protein 41/75, interferon-induced protein 75, 52kD, IPR1, phosphoprotein 41, phosphoprotein 75, SP110 nuclear body protein, Speckled 110 kDa, Transcriptional coactivator Sp110, VODI

Gene Symbol

SP110

Additional SP110 Products

Product Documents for SP110 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SP110 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SP110 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SP110 Antibody - BSA Free and earn rewards!

Have you used SP110 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies