SPACA3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-89136

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SPACA3 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: TNNGIFQINSRRWCSNLTPNVPNVCRMYCSDLLNPNLKDTVICAMKITQEPQGLGYWEAWRHHCQGKDLTEWVDGCDF

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SPACA3 Antibody - BSA Free

Western Blot: SPACA3 Antibody [NBP1-89136]

Western Blot: SPACA3 Antibody [NBP1-89136]

Western Blot: SPACA3 Antibody [NBP1-89136] - Analysis in control (vector only transfected HEK293T lysate) and SPACA3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: SPACA3 Antibody [NBP1-89136]

Immunohistochemistry-Paraffin: SPACA3 Antibody [NBP1-89136]

Immunohistochemistry-Paraffin: SPACA3 Antibody [NBP1-89136] - Staining of human testis shows strong cytoplasmic positivity in spermatids.
Immunohistochemistry-Paraffin: SPACA3 Antibody [NBP1-89136]

Immunohistochemistry-Paraffin: SPACA3 Antibody [NBP1-89136]

Immunohistochemistry-Paraffin: SPACA3 Antibody [NBP1-89136] - Staining of human endometrium shows low expression as expected.
Immunohistochemistry-Paraffin: SPACA3 Antibody [NBP1-89136]

Immunohistochemistry-Paraffin: SPACA3 Antibody [NBP1-89136]

Immunohistochemistry-Paraffin: SPACA3 Antibody [NBP1-89136] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: SPACA3 Antibody [NBP1-89136]

Immunohistochemistry-Paraffin: SPACA3 Antibody [NBP1-89136]

Immunohistochemistry-Paraffin: SPACA3 Antibody [NBP1-89136] - Staining in human testis and endometrium tissues using anti-SPACA3 antibody. Corresponding SPACA3 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: SPACA3 Antibody [NBP1-89136]

Immunohistochemistry-Paraffin: SPACA3 Antibody [NBP1-89136]

Immunohistochemistry-Paraffin: SPACA3 Antibody [NBP1-89136] - Staining of human endometrium shows no positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: SPACA3 Antibody [NBP1-89136]

Immunohistochemistry-Paraffin: SPACA3 Antibody [NBP1-89136]

Immunohistochemistry-Paraffin: SPACA3 Antibody [NBP1-89136] - Staining of human fallopian tube shows no positivity in glandular cells as expected.
Immunohistochemistry: SPACA3 Antibody [NBP1-89136]

Immunohistochemistry: SPACA3 Antibody [NBP1-89136]

Immunohistochemistry: SPACA3 Antibody [NBP1-89136] - Staining of human prostate shows no positivity in glandular cell as expected.

Applications for SPACA3 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:2500 - 1:5000

Immunohistochemistry-Paraffin

1:2500 - 1:5000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SPACA3

Sperm surface membrane protein that may be involved in sperm-egg plasma membrane adhesion and fusion duringfertilization. It could be a potential receptor for the egg oligosaccharide residue N-acetylglucosamine, which ispresent in the extracellular matrix over the egg plasma membrane. The processed form has no detectable bacteriolyticactivity in vitro

Alternate Names

CT54ALLP17Cancer/testis antigen 54, LYC3Sperm protein reactive with ASA, Lysozyme-like acrosomal sperm-specific secretory protein ALLP-17, Lysozyme-like protein 3, lysozyme-like sperm-specific secretory protein ALLP17, LYZL31700025M08Rik, SLLP1MGC119058, sperm acrosome associated 3, sperm acrosome membrane-associated protein 3, sperm lysozyme like protein 1, Sperm lysozyme-like protein 1, Sperm protein reactive with antisperm antibodies, SPRASA

Gene Symbol

SPACA3

Additional SPACA3 Products

Product Documents for SPACA3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SPACA3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SPACA3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SPACA3 Antibody - BSA Free and earn rewards!

Have you used SPACA3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies