SPATA5 Antibody - Azide and BSA Free
Novus Biologicals | Catalog # NBP3-16028
Loading...
Key Product Details
Species Reactivity
Human, Mouse, Rat
Applications
Western Blot, ELISA
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
Azide and BSA Free
Loading...
Product Specifications
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 228-304 of human SPATA5 (NP_001304728). LELSLQLSQLDLEDTQIPTSRSTPYKPIDDRITNKASDVLLDVTQSPGDGSGLMLEEVTGLKCNFESAREGNEQLTE
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
98 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for SPATA5 Antibody - Azide and BSA Free
Western Blot: SPATA5 AntibodyAzide and BSA Free [NBP3-16028]
Western Blot: SPATA5 Antibody [NBP3-16028] - Western blot analysis of extracts of Mouse pancreas, using SPATA5 antibody (NBP3-16028) at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.Western Blot: SPATA5 AntibodyAzide and BSA Free [NBP3-16028]
Western Blot: SPATA5 Antibody [NBP3-16028] - Western blot analysis of extracts of 293T cells, using SPATA5 antibody (NBP3-16028) at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.Western Blot: SPATA5 AntibodyAzide and BSA Free [NBP3-16028]
Western Blot: SPATA5 Antibody [NBP3-16028] - Western blot analysis of extracts of Rat kidney, using SPATA5 antibody (NBP3-16028) at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.Applications for SPATA5 Antibody - Azide and BSA Free
Application
Recommended Usage
ELISA
Recommended starting concentration is 1 μg/mL.
Western Blot
1:500 - 1:1000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol
Format
Azide and BSA Free
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: SPATA5
Alternate Names
AFG2ATPase family gene 2 homolog, ATPase family protein 2 homolog, SPAFspermatogenesis associated factor SPAF, spermatogenesis associated 5, Spermatogenesis-associated factor protein, spermatogenesis-associated protein 5
Gene Symbol
AFG2A
Additional SPATA5 Products
Product Documents for SPATA5 Antibody - Azide and BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for SPATA5 Antibody - Azide and BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for SPATA5 Antibody - Azide and BSA Free
There are currently no reviews for this product. Be the first to review SPATA5 Antibody - Azide and BSA Free and earn rewards!
Have you used SPATA5 Antibody - Azide and BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...