Spectrin beta 3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-48794

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Predicted:

Mouse (95%), Rat (95%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: RLWRFLWEVGEAEAWVREQQHLLASADTGRDLTGALRLLNKHTALRGEMSGRLGPLKLTLEQGQQLVAEGHPGASQASA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Spectrin beta 3 Antibody - BSA Free

Immunohistochemistry-Paraffin: Spectrin beta 3 Antibody [NBP2-48794]

Immunohistochemistry-Paraffin: Spectrin beta 3 Antibody [NBP2-48794]

Immunohistochemistry-Paraffin: Spectrin beta 3 Antibody [NBP2-48794] - Staining of human skin shows high expression.
Immunohistochemistry: Spectrin beta 3 Antibody [NBP2-48794]

Immunohistochemistry: Spectrin beta 3 Antibody [NBP2-48794]

Immunohistochemistry: Spectrin beta 3 Antibody [NBP2-48794] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: Spectrin beta 3 Antibody [NBP2-48794]

Immunohistochemistry-Paraffin: Spectrin beta 3 Antibody [NBP2-48794]

Immunohistochemistry-Paraffin: Spectrin beta 3 Antibody [NBP2-48794] - Staining of human endometrium shows low expression as expected.
Immunohistochemistry-Paraffin: Spectrin beta 3 Antibody [NBP2-48794]

Immunohistochemistry-Paraffin: Spectrin beta 3 Antibody [NBP2-48794]

Immunohistochemistry-Paraffin: Spectrin beta 3 Antibody [NBP2-48794] - Staining in human skin and endometrium tissues using anti-SPTBN2 antibody. Corresponding SPTBN2 RNA-seq data are presented for the same tissues.

Applications for Spectrin beta 3 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: beta-III Spectrin

Spectrins are principle components of a cell's membrane-cytoskeleton and are composed of two alpha and two beta spectrin subunits. The protein encoded by this gene (SPTBN2), is called spectrin beta non-erythrocytic 2 or beta-III spectrin. It is related to, but distinct from, the beta-II spectrin gene which is also known as spectrin beta non-erythrocytic 1 (SPTBN1). SPTBN2 regulates the glutamate signaling pathway by stabilizing the glutamate transporter EAAT4 at the surface of the plasma membrane.

Mutations in this gene cause a form of spinocerebellar ataxia, SCA5, that is characterized by neurodegeneration, progressive locomotor incoordination, dysarthria, and uncoordinated eye movements. Mutations in spectrins are a previously unknown cause of ataxia and neurodegenerative disease that affect membrane proteins involved in glutamate signaling. Spectrin-beta IIIs have been recognized as ataxia disease genes and their mutations cause spinocerebellar ataxia type 5 (SCA5).

Long Name

Spectrin Beta, Non-Erythrocytic 2

Alternate Names

GTRAP41, SCA5, SCAR14, Spectrin beta 3, Spectrin beta III, SPTBN2

Gene Symbol

SPTBN2

Additional beta-III Spectrin Products

Product Documents for Spectrin beta 3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Spectrin beta 3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for Spectrin beta 3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Spectrin beta 3 Antibody - BSA Free and earn rewards!

Have you used Spectrin beta 3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...