Spermine synthase Antibody (1U7C7)

Novus Biologicals | Catalog # NBP3-33548

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Rabbit IgG Clone # 1U7C7
View all Spermine synthase Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 50-150 of human Spermine synthase (P52788).

Sequence:
TYTNKNGSFANLRIYPHGLVLLDLQSYDGDAQGKEEIDSILNKVEERMKELSQDSTGRVKRLPPIVRGGAIDRYWPTADGRLVEYDIDEVVYDEDSPYQNI

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

41 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Spermine synthase Antibody (1U7C7)

Spermine synthase Antibody (1U7C7)

Western Blot: Spermine synthase Antibody (1U7C7) [NBP3-33548] -

Western Blot: Spermine synthase Antibody (1U7C7) [NBP3-33548] - Western blot analysis of various lysates using at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 10s.
Spermine synthase Antibody (1U7C7)

Western Blot: Spermine synthase Antibody (1U7C7) [NBP3-33548] -

Western Blot: Spermine synthase Antibody (1U7C7) [NBP3-33548] - Western blot analysis of various lysates using at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit.
Exposure time: 30s.

Applications for Spermine synthase Antibody (1U7C7)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Spermine synthase

Spermine synthase is 1 of 4 enzymes involved in the synthesis of polyamines from arginine and methionine. The reaction catalysed is S-adenosylmethioninamine + spermidine = methylthioadenosine + spermine.

Alternate Names

EC 2.5.1.22, MRSRSpS, Snyder-Robinson X-linked mental retardation syndrome, Spermidine aminopropyltransferase, spermine synthase, SPMSYSRS

Gene Symbol

SMS

Additional Spermine synthase Products

Product Documents for Spermine synthase Antibody (1U7C7)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Spermine synthase Antibody (1U7C7)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Spermine synthase Antibody (1U7C7)

There are currently no reviews for this product. Be the first to review Spermine synthase Antibody (1U7C7) and earn rewards!

Have you used Spermine synthase Antibody (1U7C7)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies