Sphingomyelin Synthase 2 Antibody (7D10) - Azide and BSA Free

Novus Biologicals | Catalog # H00166929-M08

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA, Knockdown Validated

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 7D10

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

Sphingomyelin Synthase 2 (NP_689834, 2 a.a. ~ 80 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DIIETAKLEEHLENQPSDPTNTYARPAEPVEEENKNGNGKPKSLSSGLRKGTKKYPDYIQIAMPTESRNKFPLEWWKTG

Reactivity Notes

Human. Other species not tested.

Specificity

MGC26963 (7D10)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Scientific Data Images for Sphingomyelin Synthase 2 Antibody (7D10) - Azide and BSA Free

Western Blot: Sphingomyelin Synthase 2 Antibody (7D10) [H00166929-M08]

Western Blot: Sphingomyelin Synthase 2 Antibody (7D10) [H00166929-M08]

Western Blot: Sphingomyelin Synthase 2 Antibody (7D10) [H00166929-M08] - Analysis of SGMS2 expression in human stomach.
Western Blot: Sphingomyelin Synthase 2 Antibody (7D10) [H00166929-M08]

Western Blot: Sphingomyelin Synthase 2 Antibody (7D10) [H00166929-M08]

Western Blot: Sphingomyelin Synthase 2 Antibody (7D10) [H00166929-M08] - Western blot analysis of MGC26963 over-expressed 293 cell line,cotransfected with MGC26963 Validated Chimera RNAi or non-transfected control. Blot probed with H00166929-M08. GAPDH(36.1 kDa)used as loading control.
Western Blot: Sphingomyelin Synthase 2 Antibody (7D10) [H00166929-M08]

Western Blot: Sphingomyelin Synthase 2 Antibody (7D10) [H00166929-M08]

Western Blot: Sphingomyelin Synthase 2 Antibody (7D10) [H00166929-M08] - Analysis of MGC26963 expression in transfected 293T cell line by MGC26963 monoclonal antibody (M08), clone 7D10. Lane 1: MGC26963 transfected lysatE (42.3 KDa). Lane 2: Non-transfected lysate.

Applications for Sphingomyelin Synthase 2 Antibody (7D10) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500RNAi Validation
Application Notes
Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. It has also been used for RNAi validation.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: Sphingomyelin Synthase 2

Sphingomyelin (SM) is a major component of plasma membranes. It is preferentially concentrated in the outer leaflet and has a role in the formation of lipid rafts. SM synthases (EC 2.7.8.27), such as SGMS2, produce SM in the lumen of the Golgi and on the cell surface through the transfer of phosphocholine from phosphatidylcholine onto ceramide, yielding diacylglycerol as a side product (Huitema et al., 2004 [PubMed 14685263]).[supplied by OMIM]

Alternate Names

EC 2.7.8.27, phosphatidylcholine:ceramide cholinephosphotransferase 2, SM synthase, sphingomyelin synthase 2SMS2MGC26963

Entrez Gene IDs

166929 (Human)

Gene Symbol

SGMS2

Additional Sphingomyelin Synthase 2 Products

Product Documents for Sphingomyelin Synthase 2 Antibody (7D10) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Sphingomyelin Synthase 2 Antibody (7D10) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Sphingomyelin Synthase 2 Antibody (7D10) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review Sphingomyelin Synthase 2 Antibody (7D10) - Azide and BSA Free and earn rewards!

Have you used Sphingomyelin Synthase 2 Antibody (7D10) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...