STAM2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-38372

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all STAM2 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 376-525 of human STAM2 (NP_005834.4).

Sequence:
KLHPPAHYPPASSGVPMQTYPVQSHGGNYMGQSIHQVTVAQSYSLGPDQIGPLRSLPPNVNSSVTAQPAQTSYLSTGQDTVSNPTYMNQNSNLQSATGTTAYTQQMGMSVDMSSYQNTTSNLPQLAGFPVTVPAHPVAQQHTNYHQQPLL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

58 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for STAM2 Antibody - BSA Free

STAM2 Antibody

Western Blot: STAM2 Antibody [NBP3-38372] -

Western Blot: STAM2 Antibody [NBP3-38372] - Western blot analysis of various lysates using STAM2 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 1s.
STAM2 Antibody

Immunocytochemistry/ Immunofluorescence: STAM2 Antibody [NBP3-38372] -

Immunocytochemistry/ Immunofluorescence: STAM2 Antibody [NBP3-38372] - Immunofluorescence analysis of U-2 OS cells using STAM2 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
STAM2 Antibody

Immunocytochemistry/ Immunofluorescence: STAM2 Antibody [NBP3-38372] -

Immunocytochemistry/ Immunofluorescence: STAM2 Antibody [NBP3-38372] - Immunofluorescence analysis of L929 cells using STAM2 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
STAM2 Antibody

Immunocytochemistry/ Immunofluorescence: STAM2 Antibody [NBP3-38372] -

Immunocytochemistry/ Immunofluorescence: STAM2 Antibody [NBP3-38372] - Immunofluorescence analysis of C6 cells using STAM2 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for STAM2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:100

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: STAM2

Alternate Names

DKFZp564C047, HBP, Hrs-binding protein, HSE1 homolog, signal transducing adapter molecule 2, signal transducing adaptor molecule (SH3 domain and ITAM motif) 2, STAM-2, STAM2A, STAM2B, STAM-like protein containing SH3 and ITAM domains 2

Gene Symbol

STAM2

Additional STAM2 Products

Product Documents for STAM2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for STAM2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for STAM2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review STAM2 Antibody - BSA Free and earn rewards!

Have you used STAM2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies