SUCNR1/GPR91 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-82350

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human SUCNR1. Peptide sequence: INPVITDNGTTCNDFASSGDPNYNLIYSMCLTLLGFLIPLFVMCFFYYKI The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

37 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for SUCNR1/GPR91 Antibody - BSA Free

Western Blot: SUCNR1/GPR91 Antibody [NBP2-82350]

Western Blot: SUCNR1/GPR91 Antibody [NBP2-82350]

Western Blot: SUCNR1/GPR91 Antibody [NBP2-82350] - Host: Rabbit. Target Name: SUCNR1. Sample Type: Fetal Heart lysates. Antibody Dilution: 1.0ug/ml
Western Blot: SUCNR1/GPR91 Antibody [NBP2-82350]

Western Blot: SUCNR1/GPR91 Antibody [NBP2-82350]

Western Blot: SUCNR1/GPR91 Antibody [NBP2-82350] - Host: Rabbit. Target Name: SUCNR1. Sample Tissue: Human Jurkat Whole Cell. Antibody Dilution: 0.5ug/ml

Applications for SUCNR1/GPR91 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SUCNR1/GPR91

GPR91 (formerly known as P2U2) is a G protein-coupled, dicarboxylic acid succinate receptor. It has a high level of expression in the kidney, predominantly in the proximal tubules, and localizes to the plasma membrane. It has also been found at low levels in the liver and the spleen. GPR91 functions as a citric acid cycle intermediate succinate receptor. Two signaling pathways result from GPR91 activation, the pertussis-toxin-sensitive Gi/Go pathway and the pertussis-toxin-insensitive Gq pathway. Four amino acid residues are necessary for GPR91 activation by succinate: Arg 99, His 103, Arg 252 and Arg 281. GPR91 plays an important role in the succinate-induced hypertensive effect and may be involved in renovascular hypertension, a disease linked to diabetes, renal failure and atherosclerosis.

Long Name

Succinate Receptor 1

Alternate Names

GPR91

Gene Symbol

SUCNR1

Additional SUCNR1/GPR91 Products

Product Documents for SUCNR1/GPR91 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SUCNR1/GPR91 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for SUCNR1/GPR91 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SUCNR1/GPR91 Antibody - BSA Free and earn rewards!

Have you used SUCNR1/GPR91 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...