SUMO Activating Enzyme E1 (SAE1) Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-13272

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SUMO Activating Enzyme E1 (SAE1/UBA2) Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: NSIKFFTGDVFGYHGYTFANLGEHEFVEEKTKVAKVSQGVEDGPDTKRAKLDSSETTMVKKKVVFCPVKEALE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SUMO Activating Enzyme E1 (SAE1) Antibody - BSA Free

Western Blot: SUMO Activating Enzyme E1 (SAE1) Antibody [NBP2-13272]

Western Blot: SUMO Activating Enzyme E1 (SAE1) Antibody [NBP2-13272]

Western Blot: SUMO Activating Enzyme E1 (SAE1) Antibody [NBP2-13272] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: SUMO Activating Enzyme E1 (SAE1) Antibody [NBP2-13272]

Immunohistochemistry-Paraffin: SUMO Activating Enzyme E1 (SAE1) Antibody [NBP2-13272]

Immunohistochemistry-Paraffin: SUMO Activating Enzyme E1 (SAE1) Antibody [NBP2-13272] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: SUMO Activating Enzyme E1 (SAE1) Antibody [NBP2-13272]

Immunohistochemistry-Paraffin: SUMO Activating Enzyme E1 (SAE1) Antibody [NBP2-13272]

Immunohistochemistry-Paraffin: SUMO Activating Enzyme E1 (SAE1) Antibody [NBP2-13272] - Staining of human testis shows high expression.
SUMO Activating Enzyme E1 (SAE1) Antibody - BSA Free Western Blot: SUMO Activating Enzyme E1 (SAE1) Antibody - BSA Free [NBP2-13272]

Western Blot: SUMO Activating Enzyme E1 (SAE1) Antibody - BSA Free [NBP2-13272]

Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
SUMO Activating Enzyme E1 (SAE1) Antibody - BSA Free Immunohistochemistry: SUMO Activating Enzyme E1 (SAE1) Antibody - BSA Free [NBP2-13272]

Immunohistochemistry: SUMO Activating Enzyme E1 (SAE1) Antibody - BSA Free [NBP2-13272]

Analysis in human testis and pancreas tissues using Anti-SAE1 antibody. Corresponding SAE1 RNA-seq data are presented for the same tissues.
SUMO Activating Enzyme E1 (SAE1) Antibody - BSA Free Western Blot: SUMO Activating Enzyme E1 (SAE1) Antibody - BSA Free [NBP2-13272]

Western Blot: SUMO Activating Enzyme E1 (SAE1) Antibody - BSA Free [NBP2-13272]

Analysis using antibody NBP2-13272 (A) shows similar pattern to independent antibody NBP2-13273 (B).

Applications for SUMO Activating Enzyme E1 (SAE1) Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For Immunofluorescence, Fixation/Permeabilization: PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SUMO Activating Enzyme E1 (SAE1/UBA2)

The dimeric enzyme acts as a E1 ligase for SUMO1, SUMO2, SUMO3, and probably SUMO4. It mediates ATP-dependent activation of SUMO proteins and formation of a thioester with a conserved cysteine residue on SAE2

Long Name

SUMO1 Activating Enzyme E1

Alternate Names

AOS1, SAE1, SUA1, UBA2, UBLE1A

Gene Symbol

SAE1

Additional SUMO Activating Enzyme E1 (SAE1/UBA2) Products

Product Documents for SUMO Activating Enzyme E1 (SAE1) Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SUMO Activating Enzyme E1 (SAE1) Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SUMO Activating Enzyme E1 (SAE1) Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SUMO Activating Enzyme E1 (SAE1) Antibody - BSA Free and earn rewards!

Have you used SUMO Activating Enzyme E1 (SAE1) Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies