SUMO4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-95198

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 40-95 of human SUMO4 (Q6EEV6). LSKLMKAYCEPRGLSMKQIRFRFGGQPISGTDKPAQLEMEDEDTIDVFQQPTGGVY

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

10 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for SUMO4 Antibody - BSA Free

Western Blot: SUMO4 AntibodyBSA Free [NBP2-95198]

Western Blot: SUMO4 AntibodyBSA Free [NBP2-95198]

Western Blot: SUMO4 Antibody [NBP2-95198] - Analysis of extracts of various cell lines, using SUMO4 at 1:800 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.
Immunohistochemistry-Paraffin: SUMO4 Antibody - BSA Free [NBP2-95198]

Immunohistochemistry-Paraffin: SUMO4 Antibody - BSA Free [NBP2-95198]

Immunohistochemistry-Paraffin: SUMO4 Antibody [NBP2-95198] - Paraffin-embedded human kidney cancer using SUMO4.
Immunohistochemistry-Paraffin: SUMO4 Antibody - BSA Free [NBP2-95198]

Immunohistochemistry-Paraffin: SUMO4 Antibody - BSA Free [NBP2-95198]

Immunohistochemistry-Paraffin: SUMO4 Antibody [NBP2-95198] - Paraffin-embedded human appendicitis using SUMO4.
Immunohistochemistry-Paraffin: SUMO4 Antibody - BSA Free [NBP2-95198]

Immunohistochemistry-Paraffin: SUMO4 Antibody - BSA Free [NBP2-95198]

Immunohistochemistry-Paraffin: SUMO4 Antibody [NBP2-95198] - Paraffin-embedded human breast cancer using SUMO4.

Applications for SUMO4 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:100-1:300

Western Blot

1:1000-1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: SUMO4

SUMO4 is a member of the SUMO gene family. This family of genes encode small ubiquitin-related modifiers that are attached to proteins and control the target proteins' subcellular localization, stability, or activity. The protein described in this record is located in the cytoplasm and specifically modifies IKBA, leading to negative regulation of NF-kappa-B-dependent transcription of the IL12B gene. A specific polymorphism in this SUMO gene, which leads to the M55V substitution, has been associated with type I diabetes. The RefSeq contains this polymorphism. [provided by RefSeq]

Long Name

Small Ubiquitin-like Modifier 4

Alternate Names

dJ281H8.4, IDDM5, small ubiquitin-like modifier 4 protein, Small ubiquitin-like protein 4, small ubiquitin-related modifier 4, SMT3 suppressor of mif two 3 homolog 2, SMT3 suppressor of mif two 3 homolog 4 (S. cerevisiae), SMT3 suppressor of mif two 3 homolog 4 (yeast), SMT3H4, SUMO-4

Gene Symbol

SUMO4

Additional SUMO4 Products

Product Documents for SUMO4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SUMO4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SUMO4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SUMO4 Antibody - BSA Free and earn rewards!

Have you used SUMO4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies