Recombinant Human Surfactant Protein A GST (N-Term) Protein

Novus Biologicals | Catalog # H00653509-P01

Novus Biologicals
Loading...

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Applications

Western Blot, ELISA, Affinity Purification, Microarray
Loading...

Product Specifications

Description

A recombinant protein with GST tag at N-terminal corresponding to the amino acids 83-199 of Human SFTPA1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MTVGEKVFSSNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRNCLYSRLTICEF

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

38.61 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human Surfactant Protein A GST (N-Term) Protein

SDS-PAGE: Recombinant Human Surfactant Protein A GST (N-Term) Protein [H00653509-P01]

SDS-PAGE: Recombinant Human Surfactant Protein A GST (N-Term) Protein [H00653509-P01]

SDS-Page: Recombinant Human Surfactant Protein A Protein [H00653509-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation, and Storage

H00653509-P01
Preparation Method in vitro wheat germ expression system
Formulation 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: SFTPA1

Surfactant protein A is a protein with two isoforms, with lengths of 248 and 263 amino acids and weights of approximately 26 and 28 kDa respectively. Surfactant protein A binds to surfactant phospholipids in the presence of calcium ions and helps lower the surface tension in the alveoli of the lungs. Current research is being done on several diseases and disorders linked to this protein including pulmonary fibrosis, allergic bronchopulmonary aspergillosis, pulmonary alveolar proteinosis, non-small cell lung carcinoma, sclerosing hemangioma, otitis media, chronic obstructive pulmonary disease, bronchitis obliterans, bronchopulmonary dysplasia, rhinitis, aspergillosis, pulmonary edema, insulin resistance, and pneumoconiosis. Surfactant protein A has also been shown to have interactions with DMBT1, MYO18A, C1QA, SFTPD, and TLR2 in pathways such as the immune response, bacterial infections in CF airways, cell-cell communication, phagosome, and pertussis pathways.

Long Name

Surfactant Protein A1

Alternate Names

COLEC4, PSP-A, SP-A, SP-A1

Gene Symbol

SFTPA1

Additional SFTPA1 Products

Product Documents for Recombinant Human Surfactant Protein A GST (N-Term) Protein

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Recombinant Human Surfactant Protein A GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for Recombinant Human Surfactant Protein A GST (N-Term) Protein

There are currently no reviews for this product. Be the first to review Recombinant Human Surfactant Protein A GST (N-Term) Protein and earn rewards!

Have you used Recombinant Human Surfactant Protein A GST (N-Term) Protein?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Proteins and Enzymes
Loading...