SV2A Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-82964
Loading...
Key Product Details
Validated by
Orthogonal Validation
Species Reactivity
Validated:
Human, Mouse
Cited:
Human
Predicted:
Rat (96%). Backed by our 100% Guarantee.
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation
Cited:
Western Blot, Immunoprecipitation
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SDGYYRGEGTQDEEEGGASSDATEGHDEDDEIYEGEYQGIPRAESGGKGERMADGAPLAGVRGGLSDGEGPPGGRGEAQRRKEREELAQQYEAILRECGHGRFQW
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for SV2A Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence: SV2A Antibody [NBP1-82964]
Immunocytochemistry/Immunofluorescence: SV2A Antibody [NBP1-82964] - Staining of human cell line U-251 MG shows localization to cytosol. Antibody staining is shown in green.Immunohistochemistry-Paraffin: SV2A Antibody [NBP1-82964]
Immunohistochemistry-Paraffin: SV2A Antibody [NBP1-82964] - Staining of human small intestine shows no positivity in glandular cells.Western Blot: SV2A Antibody [NBP1-82964]
Western Blot: SV2A Antibody [NBP1-82964] - Analysis of SV2A in (1) undifferentiated SH-SY5Y, (2) differentiated SH-SY5Y (neurons) and (3) mouse brain using anti-SV2A antibody. 30ug of protein/lane. Image from verified customer review.Immunohistochemistry-Paraffin: SV2A Antibody [NBP1-82964]
Immunohistochemistry-Paraffin: SV2A Antibody [NBP1-82964] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuropil.Immunohistochemistry-Paraffin: SV2A Antibody [NBP1-82964]
Immunohistochemistry-Paraffin: SV2A Antibody [NBP1-82964] - Staining of human cerebellum shows strong cytoplasmic positivity in neuropil.Immunohistochemistry-Paraffin: SV2A Antibody [NBP1-82964]
Immunohistochemistry-Paraffin: SV2A Antibody [NBP1-82964] - Staining of human pancreas shows strong cytoplasmic positivity in islets of Langerhans.Immunoprecipitation: SV2A Antibody [NBP1-82964]
Immunoprecipitation: SV2A Antibody [NBP1-82964] - Staining of neuroblastoma cells SH-SY5Y differentiated into neurons. Lane (1) 10ug of input, 500ug used for IP. 10ul of antibody used for incubation with lysate (overnight incubation at 4C with rotation) prior to addition of beads. Image from verified customer review.Applications for SV2A Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:200 - 1:500
Immunohistochemistry-Paraffin
1:200 - 1:500
Immunoprecipitation
Reported in scientific literature (PMID: 24284412)/verified customer review.
Western Blot
Reported in scientific literature (PMID: 24284412)/verified customer review.
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization, Use PFA/Triton X-100.
Reviewed Applications
Read 2 reviews rated 4 using NBP1-82964 in the following applications:
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: SV2A
Long Name
Synaptic Vesicle Glycoprotein 2A
Alternate Names
KIAA0736, SV2
Gene Symbol
SV2A
Additional SV2A Products
Product Documents for SV2A Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for SV2A Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for SV2A Antibody - BSA Free
Customer Reviews for SV2A Antibody - BSA Free (2)
4 out of 5
2 Customer Ratings
Have you used SV2A Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Customer Images
Showing
1
-
2 of
2 reviews
Showing All
Filter By:
-
Application: Western BlotSample Tested: L1: undifferentiated SH-SY5Y, L2: differentiated SH-Sy5Y (neurons), L3: Mouse BrainSpecies: Mouse and HumanVerified Customer | Posted 01/28/2015SV2A Western Blot
-
Application: ImmunoprecipitationSample Tested: Neuroblastoma cells SH-SY5Y differentiated into neuronsSpecies: HumanVerified Customer | Posted 01/28/2015SV2A IP
There are no reviews that match your criteria.
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Immunoprecipitation Protocol
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...