Synapsin II Antibody (7J6L0)

Novus Biologicals | Catalog # NBP3-15765

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 7J6L0 expressed in HEK293
View all Synapsin II Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 200-300 of human Synapsin II (Q92777). HLIIGMQYAGLPSINSLESIYNFCDKPWVFAQLVAIYKTLGGEKFPLIEQTYYPNHKEMLTLPTFPVVVKIGHAHSGMGKVKVENHYDFQDIASVVALTQT

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Synapsin II Antibody (7J6L0)

Western Blot: Synapsin II Antibody (7J6L0) [NBP3-15765]

Western Blot: Synapsin II Antibody (7J6L0) [NBP3-15765]

Western Blot: Synapsin II Antibody (7J6L0) [NBP3-15765] - Western blot analysis of extracts of 293T cells, using Synapsin II Rabbit mAb (NBP3-15765) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.
Synapsin II Antibody (7J6L0)

Immunocytochemistry/ Immunofluorescence: Synapsin II Antibody (7J6L0) [Synapsin II] -

Immunocytochemistry/ Immunofluorescence: Synapsin II Antibody (7J6L0) [Synapsin II] - Confocal imaging of paraffin-embedded Mouse brain using Synapsin II Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform microwave antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.
Synapsin II Antibody (7J6L0)

Immunocytochemistry/ Immunofluorescence: Synapsin II Antibody (7J6L0) [Synapsin II] -

Immunocytochemistry/ Immunofluorescence: Synapsin II Antibody (7J6L0) [Synapsin II] - Confocal imaging of paraffin-embedded Rat brain using Synapsin II Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform microwave antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.

Applications for Synapsin II Antibody (7J6L0)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Synapsin II

Synapsin II is a member of the synapsin gene family. Synapsins are neuronal phosphoproteins which associate with the cytoplasmic surface of synaptic vesicles. Family members are characterized by common protein domains, and they are implicated in synaptogenesis and the modulation of neurotransmitter release, suggesting a potential role in several neuropsychiatric diseases. This member of the synapsin family is a neuron-specific phosphoprotein that selectively binds to small synaptic vesicles in the presynaptic nerve terminal.

Alternate Names

synapsin IISYNII, synapsin-2, SYNIIa, SYNIIb

Gene Symbol

SYN2

Additional Synapsin II Products

Product Documents for Synapsin II Antibody (7J6L0)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Synapsin II Antibody (7J6L0)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Synapsin II Antibody (7J6L0)

There are currently no reviews for this product. Be the first to review Synapsin II Antibody (7J6L0) and earn rewards!

Have you used Synapsin II Antibody (7J6L0)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies