TAF2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-86842

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Biological Validation

Species Reactivity

Human

Applications

Western Blot, Chromatin Immunoprecipitation (ChIP)

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all TAF2 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TAF2. Peptide sequence: RKRNVLELEIKQDYTSPGTQKYVGPLKVTVQELDGSFNHTLQIEENSLKH The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for TAF2 Antibody - BSA Free

Western Blot: TAF2 Antibody [NBP2-86842]

Western Blot: TAF2 Antibody [NBP2-86842]

Western Blot: TAF2 Antibody [NBP2-86842] - WB Suggested Anti-TAF2 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:12500. Positive Control: 293T cell lysateTAF2 is supported by BioGPS gene expression data to be expressed in HEK293T
Chromatin Immunoprecipitation: TAF2 Antibody [NBP2-86842] - Quiescent human colon carcinoma HCT116 cultures were treated with 10% FBS for three time points (0, 15, 30min) or (0, 30, 60min) were used in Matrix-ChIP and real-time PCR assays at EGR1 gene (Exon1) and 15kb upstream site.

Applications for TAF2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TAF2

TAF2 is a component of the multi-subunit TFIID transcription factor. The TFIID complex is important for coordinating the pre-initiation complex and transcription by RNA Pol II. The complex contains the TFIID protein, TATA binding protein (TBP) and multiple TBP-associated factors (TAFs). TAF2 has been shown to play an important role in gene expression required for progression through the cell cycle.

Alternate Names

150 kDa cofactor of initiator function, CIF150TAFII-150, cofactor of initiator function, 150kD subunit, TAF(II)150, TAF2 RNA polymerase II, TATA box binding protein (TBP)-associated factor, TAF2B, TAFII150RNA polymerase II TBP-associated factor subunit B, TATA box binding protein (TBP)-associated factor, RNA polymerase II, B, 150kD, TBP-associated factor 150 kDa, Transcription initiation factor TFIID 150 kDa subunit, transcription initiation factor TFIID subunit 2

Gene Symbol

TAF2

Additional TAF2 Products

Product Documents for TAF2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TAF2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TAF2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TAF2 Antibody - BSA Free and earn rewards!

Have you used TAF2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies