TAF8 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-38188

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (99%), Rat (100%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: PHTYIKTPTYREPVSDYQVLREKAASQRRDVERALTRFMAKTGETQSLFKDDVSTFPLIAARPFTIPYL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for TAF8 Antibody - BSA Free

Western Blot: TAF8 Antibody [NBP2-38188]

Western Blot: TAF8 Antibody [NBP2-38188]

Western Blot: TAF8 Antibody [NBP2-38188] - Analysis in control (vector only transfected HEK293T lysate) and TAF8 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/ Immunofluorescence: TAF8 Antibody [NBP2-38188]

Immunocytochemistry/ Immunofluorescence: TAF8 Antibody [NBP2-38188]

Immunocytochemistry/Immunofluorescence: TAF8 Antibody [NBP2-38188] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus.
Immunohistochemistry-Paraffin: TAF8 Antibody [NBP2-38188]

Immunohistochemistry-Paraffin: TAF8 Antibody [NBP2-38188]

Immunohistochemistry-Paraffin: TAF8 Antibody [NBP2-38188] - Staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: TAF8 Antibody [NBP2-38188]

Immunohistochemistry-Paraffin: TAF8 Antibody [NBP2-38188]

Immunohistochemistry-Paraffin: TAF8 Antibody [NBP2-38188] - Staining of human lymph node shows weak nuclear positivity in non-germinal center cells.
Immunohistochemistry-Paraffin: TAF8 Antibody [NBP2-38188]

Immunohistochemistry-Paraffin: TAF8 Antibody [NBP2-38188]

Immunohistochemistry-Paraffin: TAF8 Antibody [NBP2-38188] - Staining of human placenta shows moderate nuclear positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: TAF8 Antibody [NBP2-38188]

Immunohistochemistry-Paraffin: TAF8 Antibody [NBP2-38188]

Immunohistochemistry-Paraffin: TAF8 Antibody [NBP2-38188] - Staining of human prostate shows weak to moderate nuclear positivity in glandular cells.

Applications for TAF8 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TAF8

TAF8 encodes one of several TATA-binding protein (TBP)-associated factors (TAFs), which are integral subunits of the general transcription factor complex TFIID. TFIID recognizes the core promoter of many genes and nucleates the assembly of a transcription preinitiation complex containing RNA polymerase II and other initiation factors. The protein encoded by this gene contains an H4-like histone fold domain, and interacts with several subunits of TFIID including TBP and the histone-fold protein TAF10. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq]

Alternate Names

45/50kDa, FLJ32821, II, Protein taube nuss, RNA polymerase II, 43 kD, TAF(II)43,43, TAF8 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 43kDa, TATA box binding protein (TBP)-associated factor, RNA polymerase II, A, taube nuss homolog (mouse), TBP-associated factor 43 kDa, TBP-associated factor 8, transcription initiation factor TFIID subunit 8

Gene Symbol

TAF8

UniProt

Additional TAF8 Products

Product Documents for TAF8 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TAF8 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TAF8 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TAF8 Antibody - BSA Free and earn rewards!

Have you used TAF8 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...