TAO Kinase 1 Antibody (6L4S9)

Novus Biologicals | Catalog # NBP3-33291

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Rabbit IgG Clone # 6L4S9
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 900-985 of human TAO Kinase 1 (NP_065842.1).

Sequence:
FSHSYPGASGWSHNPTGGPGPHWGHPMGGPPQAWGHPMQGGPQPWGHPSGPMQGVPRGSSMGVRNSPQALRRTASGGRTEQGMSRS

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

116 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for TAO Kinase 1 Antibody (6L4S9)

TAO Kinase 1 Antibody (6L4S9)

Western Blot: TAO Kinase 1 Antibody (6L4S9) [NBP3-33291] -

Western Blot: TAO Kinase 1 Antibody (6L4S9) [NBP3-33291] - Western blot analysis of various lysates, using TAO Kinase 1 Rabbit mAb at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 3s.

Applications for TAO Kinase 1 Antibody (6L4S9)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: TAO Kinase 1

TAOK1, a member of the Ste20 kinase family, is a TAO type protein kinase that acts as an upstream activator to MARK by phosphorylation. When activated, MARK enhances microtubule dynamics and leads to phosphorylation and detachment of tau or equivalent MAPs from microtubules. Overexpression of MARK eventually leads to microtubule breakdown and cell death, but in neuronal cells the primary effect is to allow the development of neurites during differentiation.

Long Name

Serine/threonine-protein kinase TAO1

Alternate Names

hKFC-B, hTAOK1, KIAA1361, MAP3K16, MARK Kinase, MARKK, PSK-2, PSK2, TAOK1

Gene Symbol

TAOK1

Additional TAO Kinase 1 Products

Product Documents for TAO Kinase 1 Antibody (6L4S9)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TAO Kinase 1 Antibody (6L4S9)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TAO Kinase 1 Antibody (6L4S9)

There are currently no reviews for this product. Be the first to review TAO Kinase 1 Antibody (6L4S9) and earn rewards!

Have you used TAO Kinase 1 Antibody (6L4S9)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...