Tesmin Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59090

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Tesmin Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to MTL5(metallothionein-like 5, testis-specific (tesmin)) The peptide sequence was selected from the N terminal of MTL5. Peptide sequence EAYLGPADPKEPVLHAFNPALGADCKGQVKAKLAGGDSDGGELLGEYPGI. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Tesmin Antibody - BSA Free

Western Blot: Tesmin Antibody [NBP1-59090]

Western Blot: Tesmin Antibody [NBP1-59090]

Western Blot: Tesmin Antibody [NBP1-59090] - Human Brain lysate, concentration 0.2-1 ug/ml.

Applications for Tesmin Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Tesmin

Metallothionein proteins are highly conserved low-molecular-weight cysteine-rich proteins that are induced by and bind to heavy metal ions and have no enzymatic activity. They may play a central role in the regulation of cell growth and differentiation and are involved in spermatogenesis. MTL5 is a metallothionein-like protein which has been shown to be expressed differentially in mouse testis and ovary.Metallothionein proteins are highly conserved low-molecular-weight cysteine-rich proteins that are induced by and bind to heavy metal ions and have no enzymatic activity. They may play a central role in the regulation of cell growth and differentiation and are involved in spermatogenesis. This gene encodes a metallothionein-like protein which has been shown to be expressed differentially in mouse testis and ovary. Two transcript variants encoding different isoforms have been found for this gene.

Alternate Names

CXC domain containing 2, CXCDC2, Metallothionein-like 5, testis-specific, metallothionein-like 5, testis-specific (tesmin), MTLT, tesmin, Testis-specific metallothionein-like protein

Gene Symbol

MTL5

UniProt

Q9Y4I5 (Human)

Additional Tesmin Products

Product Documents for Tesmin Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Tesmin Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Tesmin Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Tesmin Antibody - BSA Free and earn rewards!

Have you used Tesmin Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies